KEGG   Macaca mulatta (rhesus monkey): 697368Help
Entry
697368            CDS       T01028                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    697368 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 2190 aa AA seqDB search
MVANFFKSLILPYIHKLCKGMFTKKLGNTNKKKEYRQQRKDQDFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTKEDEASKEFSLSPTFSYRVAIANGLQKNTKVTNSDHEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHSLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTIRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEDRFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMDMKLSTPEPKIKNNWQSPDDSDEDLESDLNRNSYAVLSKSELPTKGSTSK
PSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSDF
FTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDSP
KDQHLNGSIQGIQGQTEIENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEWN
QVEQGADLGLDSSTQEGFDYETNSLSDQQLGVYNKDLEYLGKCHSDLQDDSESYDLTQDD
NSSPCPGLDNGPQGQWVGQYDSYQGANSNELYQNQNQLSVMYGSQSELQSDDSEDAPPKS
WHSRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQ
STANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITET
DEQIQEYDHLLYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMDIREDENQNIPEQ
PVEITKPKRIRPSFKEAALRAYKKQMAELEERILAGDSSSVDEKARIVSGNDLDACKFSA
LQVCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKM
HVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEK
CQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKE
DFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKT
IFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRT
LSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVK
SNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVP
AVMSTLLANINAFYAHTTISTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYR
ENFPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIF
DNCHELYSQLIDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFP
QELNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPAF
KDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSEHALFSCSVVDVFA
QLNQSFEIIKKLECPNPEALSHLMRRFAKPCILMNNIQQLRVQLEKMFESMGGKELDSEA
STILKELQVKLSGVLDELSVTYGESFQVIIEECIKQMSFELNQMRANGNTTSNKNSAAMD
AEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKLVLNKIEKQIVLPPLTDQTGPQM
IFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAIMEVVLATIKQYFHAGGNGLKKNFLEKS
PDLQSLRYALSLYTQTTDALIKKFIDTQTSQSLSSKDAVGQISVHVDITATPGTSDHKVT
VKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKKRKQGTKTKSNTWSPKYNETFQFILGK
ENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGSYGAWYPLLKNIFMDETGLTI
LRILSQRTSDDVAREFVRLKSETRSPEESA
NT seq 6573 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaattttttcaagagcttgattttaccttacattcataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaacaaaaaaaaagagtatcgtcagcagagaaag
gatcaagactttcctactgctggccagaccaaatcccccaaattttcttatacctttaaa
agcactgtaaagaagattgcaaagtgttcatctactcacaacttatccaccaaggaagac
gaggctagtaaagagttttccctctcgccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatactaaagtaaccaacagtgaccatgaggatctgcttcaagagctg
tcttcaattgagagttcctactcagaatcattaaatgaactaaggagtagcacagaaaac
caggcacaatcaacacacacaatgccagttagacgcaacagaaagagttcaagcagcctt
gcaccctctgagggcagctctgatggggagcgtactctacatagcttaaaactgggggct
ttacgaaaactgagaaaatggaaaaagagtcaagagtgtgtctcctcagactccgagtta
agcaccatgaaaaaatcctggggaataagaagcaagtctttggacagaactatccgaaac
ccaaagacaaatgccctggaaccagggttcagttcctctggctgcattagccagacacat
gatgtcatggaaatgatctttaaggaacttcagggaataagtcagattgaaacagaactt
tctgaactacgagggcatgtcaatgctctcaagcactccatcgatgagatctctagcagt
gtggaggttgtacaaagtgaaattgagcagctacgtacagggtttgtccagtcccggagg
gaaactagagacatccatgattatattaagcacttaggtcatatgggtagcaaggcaagc
ctgagatttttaaatgtgcctgaagacagatttgaatatgttgaaagtgtggtgtaccaa
attctaatagataaaatgggtttttcagatgcaccaaatgctattaaaattgaatttgct
cagaggataggacaccagagggactgtccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcagcaaagggattctgtcttaaaaaaatcatataaactcaaaggaaca
ggcattggaatttcaacagatattctaactcatgacatcagagaaagaaaagagaaaggg
ataccatcctcccagacatacgagagtatggatatgaagttgtctactccagagccaaaa
atcaagaacaattggcagtcacctgatgacagtgatgaagatcttgaatctgacctcaat
agaaacagttatgctgtgctttccaagtcagagcttccaacaaagggaagtacttccaag
ccaagctcaaaatcacacagtgctagatccaagaataaaactgctaatagcagcagaatt
tcaaataaatcagattatgataaaatctcctcacagttgccagaatcagatatcttggaa
aagcaaaccacaacccattatgcagatgcaacacctctctggcactcacagagtgatttt
ttcactgctaaacttagtcgttctgaatcagatttttccaaattgtgtcagtcttactca
gaggatttttcagaaaatcagtttttcactagaactaatggaagctctctcctgtcatct
tcggaccgggagctatggcaaaggaaacaggaaggaacagcgaccctgtatgacagtccc
aaggaccagcatttgaatggaagtattcagggtatccaagggcagactgaaattgaaaac
acagaaactgtggatagtggaatgagtaatggcatggtgtgtgcatctggagaccggagt
cattacagtgattctcagctctctttacatgaggatctttctccatggaaggaatggaat
caagtagagcaaggagctgatttaggcttggattcatccacccaggaaggttttgattat
gaaacaaatagtctttctgaccaacagctgggtgtttacaataaagacctagaatacttg
ggaaagtgccacagtgatcttcaagatgactcagagagctacgacttaactcaagatgac
aactcttctccatgccctggcttggataatggaccacaaggccaatgggttggccaatat
gattcttatcagggagctaattctaatgagctttaccaaaatcaaaaccagttgtccgtg
atgtatggaagtcaaagtgaattgcaaagtgatgattcagaggatgccccacccaaatca
tggcatagtcgattaagcattgacctttctgataagactttcagctttccaaaatttgga
tctacattgcagagggctaaatcagccttggaagtagtatggaacaaaagcacacagagt
ctgagtgggtatgaggacagtggctcttcattaatggggagatttcggacattatctcaa
tcaactgcaaatgagtcaagtaccacgcttgactctgatgtctacacggagccctattac
tataaagcagaggatgaggaggattatactgaaccagtggctgataatgaaacagattat
gttgaagtgatggaacaagtccttgctaaactagaaaacaggactagtattactgaaaca
gatgaacaaatacaagaatatgatcaccttttatatgaaacaccttatgaaactccacaa
gatgagggttatgatggtccggcagatgatatggttagtgaagagggattagaaccctta
aatgaaacatcagctgagatggatataagagaagatgaaaaccaaaacattcctgaacag
ccagtggagatcacaaagccaaagagaattcgtccttctttcaaagaagcagctttaagg
gcctataaaaaacaaatggcggagttggaagagaggatcttggctggagatagcagttct
gtggatgaaaaggctcgaatagtaagcggcaatgatttggatgcttgcaaattctctgca
ctccaggtgtgtggtggggcaggaggtggactttacggtattgacagcatgccagatctc
cgcagaaaaaagactttgcctattgtccgagatgtggccatgaccctggctgccaggaaa
tctggactctccctggctatggtgattaggacatccctaaataatgaggaactgaaaatg
cacgtcttcaagaagaccttgcaggcattgatctaccctatgtcttctaccaccccacac
aattttgaggtctggacagctaccacgcccacctactgttatgaatgtgaggggctcctg
tggggcattgcaaggcaaggcatgaagtgtctggagtgcggagtgaaatgccacgaaaag
tgtcaggacctgctaaatgctgactgcttgcagagagcagcagaaaagagttctaaacat
ggtgccgaagacaagactcagaccattattacagcaatgaaagaaagaatgaagatcagg
gagaaaaaccggccagaagtatttgaagtaatccaggaaatgtttcagatttctaaagaa
gattttgtgcagtatacaaaggcggccaaacagagtgtactggatgggacatccaagtgg
tctgcaaaaataaccattacagtggtttctgcacagggtctacaagcaaaagataaaaca
gggtctagtgatccgtatgttacagttcaagttggaaagaacaaaagaagaacaaaaacc
atttttggaaacttgaatccagtatgggatgagaagttttattttgagtgtcataactcc
acagatcgaatcaaagtcagagtatgggatgaagatgatgatattaaatccagagtcaag
caacatttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtgaggacc
ttgagtggagaaatggatgtctggtacaacttagagaaaaggacagataagtcagctgta
tctggggccatacgattgaaaatcaatgtggagataaaaggagaagagaaggttgctcca
tatcatattcaatatacctgtttacatgagaatctgttccattacttgactgaagtgaaa
tctaatggtggagtgaaaatcccagaagtcaaaggggatgaagcctggaaggttttcttt
gatgatgcttcccaggaaatagttgatgaatttgctatgcgttatggaattgaatccatt
tatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccctggtgtccct
gctgtcatgagcaccttgctggctaatataaatgctttttatgctcacacaacaatttca
acaaatgtacaggtttctgcttcagatcgatttgctgctaccaactttggtagggaaaaa
ttcataaaactactggaccagttgcataactctctgaggattgatctgtcaaagtatagg
gaaaactttcctgcaagcaatactgaaagactgcaagacctgaaatcaactgttgacctg
ctaacaagtatcaccttttttaggatgaaggttctggagctgcaaagccccccaaaagca
agcatggtggtgaaagactgtgtaagggcttgcctggattctacatacaagtatattttt
gacaattgccatgaactctactcccagctaatagacccgagtaagaaacaggacattcct
cgtgaagatcagggaccaaccaccaagaatttggatttttggccccaacttattacactg
atggtcactattattgatgaggataaaactgcctacacacctgtcctgaatcagtttcct
caagagctgaacatgggaaaaataagtgccgaaattatgtggactctttttgctctggat
atgaaatatgcattagaagaacatgaaaatcagcggttatgcaagagcactgattatatg
aacttgcatttcaaagttaaatggttttataatgaatatgtgcgtgaacttcccgccttc
aaggatgctgttcctgaatactccttgtggtttgaaccttttgtcatgcagtggctagat
gaaaacgaagatgtgtcgatggaattccttcatggagcattgggaagagacaaaaaagat
ggattccagcagacatctgagcatgccctcttttcttgctccgtggttgatgtgtttgct
cagctgaatcagagctttgagattattaagaaactggaatgccctaatcctgaagcgtta
tctcacttaatgagaagatttgcaaagccctgtatcttgatgaacaatattcaacaattg
cgggtccagctggaaaaaatgtttgaatccatgggagggaaagagctagattctgaagct
agtactattctaaaagaacttcaggttaagctcagtggagtcctggatgagctcagcgtc
acgtacggtgaaagtttccaggttataattgaagagtgtataaaacagatgagtttcgaa
ttaaatcaaatgagagcaaatggaaacaccacatctaataagaacagtgcagcaatggat
gcagagattgtgttaagacctctcatggattttttggacaagacattaagtctctcagca
aaaatctgtgagaaaacagtcctaaagagagttttgaaagagttatggaagctagttctc
aataaaatagaaaaacaaatcgttcttcctcctctgacagatcaaacaggaccccagatg
attttcattgcagctaaagatcttggacaattatccaaactgaaggagcacatgattcga
gaggatgccaagggtctgacgccaagacaatgcgctataatggaggtagtcctggctacc
atcaagcaatactttcatgcaggaggaaatggcctgaaaaagaatttcttggagaaaagc
ccagatcttcagtctctgagatatgctctcagtctttatacccaaactactgatgccttg
ataaagaaattcatagatactcaaacctcacagagtctttcctccaaagatgccgtgggt
cagatatctgttcatgtggacatcacagccacccctggaacgagcgatcataaagtcact
gtaaaagtgattgccattaatgacctaaactggcagaccacagccatgttccgccccttt
gtggaagtttgtatactgggaccaaaccttggagacaagaagagaaagcaaggcacaaaa
acaaaaagcaacacgtggtcaccaaaatacaatgaaacatttcagttcattctgggaaag
gaaaatcgaccaggggcttatgaacttcatctctcagttaaggattactgctttgccaga
gaagatcgaattatcggaatgacagtcattcagctacagaacatagcagaaaagggaagc
tatggggcatggtatcctcttctgaaaaatatctttatggatgaaactggtttgactatc
cttagaatactctctcagaggaccagtgatgatgtggctagagaatttgtaagacttaaa
tccgaaacaagatctcctgaagagagtgcttga

DBGET integrated database retrieval system