KEGG   Macaca mulatta (rhesus monkey): 697393Help
Entry
697393            CDS       T01028                                 

Gene name
UNC13B
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    697393 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 1583 aa AA seqDB search
MVTAFWEILIFPEDRILGFPLSLSEISRLDLGLSVEVWNKGLIWDTMVGTVWIALKTIRQ
SDEEGPGEWSTLEAETLMKDDEICGTRNPTPHKILLDTRFELPFDIPEEEARYWTYKWEQ
INALGADNEYSSQEESRRKPLPTAAAQCSFEDPDSAVDDRDSDYRSETSNSIPPPYHTTS
QPNASVHQFPVPVGLPQQLLLQGSSRDSCNDSMQSYDFDYPERRAISPTSSSRYGSSCNV
SQGSSQLSELDQYHEQDDDHRERDSIHSCHSSNSLSRDGQAGFREQEKPLEVTVQAEKEA
ACEPKETKEDATTYPPPDLMLHKDHFLGPQESFPEENVSSPFTQARAHWIRAVTKVRLQL
QEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGITSAMAT
RTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMR
CSECGVKCHEKCQDLLNADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFE
VIRDVFTVSKAAHVQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTV
QVGKTKKRTKTIFGNLNPVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDD
FLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHMQYTCLH
ENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFAC
LSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNS
LRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKAC
LNSTYEYIFNNCHDLYSHQYQLKQELPPEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYT
PVLNQFPQELNVGKVSAEVMWHLFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEY
VRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVSLEFLHGALERDKKDGFQQTSEHALFSC
SVVDVFTQLNQSFEIIRKLECPDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKE
KLPCILMNNMQQLRVQLEKMFEAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQ
VRIDECVRQMADILGQVRGTGNASPDARASATQDADSVLRPLMDFLDGNLTLFATVCEKT
VLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQLIFTAAKELSHLSKLKDHMVREETRNL
TPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVR
SQTTQVHDGKGIRFTANEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAAN
DLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESY
ELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQR
SNDEVAREFVKLKSESRSTEEGS
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccgcattctgggaaattttgattttccctgaagacaggatcctgggctttcct
ctttctcttagtgagattagtcgcctggacctgggtctaagtgtggaggtatggaacaaa
ggactgatctgggacaccatggtggggactgtgtggattgcactgaagactattcgtcag
tcggatgaggaagggcctggggaatggtccacattggaggcagagacgttaatgaaagat
gatgagatctgtggaactagaaacccaactcctcataaaattttgcttgatacaagattt
gagttgccttttgatatcccagaggaggaagccagatattggacctacaaatgggagcaa
atcaatgccttgggagctgacaatgagtattctagtcaagaagaaagccggaggaagcca
ttgcccactgctgccgcccagtgttcttttgaagaccctgatagtgccgtcgatgaccga
gatagtgactatcgcagtgagaccagcaacagcatcccacctccttaccatacaacttcc
cagcccaacgcttctgtgcaccagttccctgtgccggtgggattaccgcagcagctgcta
cttcaaggcagttcccgggactcttgtaatgattctatgcaaagttatgacttcgattat
cctgagcggcgggccatcagccccaccagcagcagtaggtatggctcctcctgtaatgtg
agtcaaggaagctctcagctaagtgagctagaccagtatcatgaacaagatgacgaccat
cgggagagggactcaattcattcttgccacagctctaacagcctgtccagagatggccaa
gcaggtttcagagaacaagagaaacccttggaggtgacagttcaagcagagaaggaggca
gcatgtgaacccaaggagacgaaagaagatgccacaacctaccctcccccagatctgatg
ctgcacaaagaccacttcctaggtcctcaggaaagttttcctgaggagaatgtatcttca
ccatttacccaagccagagcacattggatccgagcagttaccaaggttcgactccagctg
caggagattccagatgatggtgatccctctctgcctcagtggctcccggaagggccagcc
ggagggctctatggcattgacagcatgccagatttacgcagaaagaagccactgccactt
gtcagtgatctgtcactggtccagtctcggaaggcaggaatcacttctgcaatggctaca
cgcacttctcttaaggatgaagagctgaaatcccacgtgtataagaaaaccctgcaggcc
ttaatctaccccatttcgtgcaccactcctcacaactttgaggtctggacagccactacc
ccaacctactgctatgagtgtgaaggcctcctctggggcattgcccgtcagggcatgcgc
tgcagtgaatgtggagtcaagtgccatgagaagtgccaggacctgctcaatgctgactgc
ctgcagcgggctgcagaaaagagctgtaaacatggagctgaggaccggacccagaacatt
atcatggccatgaaggaccgcatgaagatccgagagcgaaataagccagagatctttgaa
gttatacgggacgtcttcacagtgagcaaagctgcccatgtgcagcagatgaaaacagtg
aagcagagtgtactggatggcacctccaaatggtcggccaagatcaccattactgtggtg
tgtgcccagggcctacaagccaaggacaaaacaggatccagtgacccttacgtgactgtg
caagtcggcaaaaccaagaagcgtaccaagaccatttttggaaacttgaatcctgtttgg
gaggaaaagttccattttgagtgccacaactcctctgaccgcattaaggtgcgtgtgtgg
gatgaggatgatgacatcaagtcaagagtaaagcaacgcctaaagcgagagtccgatgat
ttcctcggccaaaccatcattgaggttcggaccctaagtggcgagatggacgtctggtac
aacttggagaagaggacagacaaatcagccgtctcaggggctatccgactacaaatcagt
gtggagatcaagggggaggagaaagtagccccataccacatgcagtatacgtgtctccat
gagaaccttttccattacctcacagacattcagggcagtggaggagtccgcatccctgaa
gctcgaggagacgatgcctggaaggtgtactttgatgagacagcccaagaaattgtggat
gaatttgccatgcgttatggcattgagtccatatatcaggccatgacgcactttgcatgt
ttatcatccaagtacatgtgtcctggtgtgccagcagtgatgagcaccttactggccaac
atcaatgcctactatgcccacacaactgcctctaccaatgtctctgcctctgatcgcttc
gcagcctccaactttgggaaagagagatttgtaaaactgctggaccagctacacaactca
ctgaggatcgacctctctacatacaggaataatttccctgctgggagtcctgaacggctt
caggacttaaaatccacagtggatttgctgaccagcattactttcttcagaatgaaggta
caagaactgcaaagccctccaagagccagccaggtggtaaaggattgtgtgaaggcctgt
ttgaactccacatatgaatatatcttcaacaactgccacgacttatacagccaccagtac
cagctgaagcaggagctacctccagaggaacaagggcccagcattcggaacctggatttc
tggcccaagctcatcacacttatcgtgtcaatcatagaggaagataagaattcctacaca
cctgttctgaaccagtttcctcaggagttgaatgtgggaaaagtcagcgcagaagtgatg
tggcatctgtttgcccaagacatgaaatatgcattggaggagcatgagaaagaccgcctg
tgtaagagtgctgactacatgaacctgcacttcaaggtgaaatggctccacaatgaatac
gtgcgggatctgcctgtcctccaggggcaggtgcctgagtacccagcgtggtttgagcag
tttgtgctacaatggctggatgagaatgaggatgtatccctggaattcctgcatggggcc
ctggagcgagataagaaggatggattccagcagacatcagagcatgcactcttttcctgc
tctgtggtggatgtcttcacacaactcaatcagagctttgagatcatccggaagctggaa
tgcccagaccccagcatccttgcccactacatgaggaggtttgctaagaccattgggaag
gtgctgatgcaatatgcagacatcttgtcaaaggacttcccagcctattgcacaaaggag
aaactgccctgcatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatg
tttgaggccatgggaggcaaggagctggaccttgaagctgcagacagtctgaaggagctg
caggtgaaactgaatacggttctggatgagctcagcatggtgtttggaaacagtttccag
gtacggattgatgagtgtgttcgacaaatggccgacatcctgggccaggttcggggcaca
gggaatgcatctccagacgccagggcctcagcgactcaggatgcagatagcgtgctccgg
cctctcatggacttcctggatggcaacctcaccctctttgccactgtgtgtgagaagacg
gttctgaagcgtgtactgaaggagctctggcgcgtggtgatgaacacaatggagaggatg
attgttctgcccccactcactgaccagacgggcacccagctgatcttcactgctgccaag
gagctgagccatctttccaaactcaaggatcacatggtgcgagaggaaacacggaatctc
actccaaagcagtgtgcagtccttgacctcgccctggacaccatcaagcaatacttccat
gcaggaggcaatgggctgaagaaaaccttcctggagaagagtccagatctacagtcttta
cgctatgccctgtctctgtacacacagactactgacactctcatcaagacctttgtgcgc
tcgcagaccacccaagtgcatgatgggaaaggtattagatttactgctaatgaggacatt
cggccggaaaaggggtctggtgtggacgatcctgtgggagaagtctctattcaggtggac
ttgtttacacacccgggtactggggagcacaaggtcacagtgaaagtggtggctgccaat
gacctcaagtggcagacagcgggtatgttccggcctttcgtggaggtgaccatggttggc
ccacaccaaagtgataagaagaggaagttcacaaccaagtccaaaagcaacaactgggct
cccaagtacaatgagacattccacttcctcctgggaaatgaagaggggcccgagtcctat
gagttgcagatatgcgtgaaggattactgctttgcccgggaagatcgcgtgctagggctg
gctgtgatgcctctgagggatgtcacagccaagggcagctgtgcctgctggtgccccttg
ggccggaagatccacatggatgagacaggcctgaccattctccggattttgtctcagagg
agcaatgatgaggtggcccgagaatttgtgaaactcaaatcagagtctcgttccacagag
gaggggagctga

DBGET integrated database retrieval system