KEGG   Macaca mulatta (rhesus monkey): 697393Help
Entry
697393            CDS       T01028                                 

Gene name
UNC13B
Definition
(RefSeq) unc-13 homolog B
  KO
K15293  
protein unc-13 A/B/C
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    697393 (UNC13B)
Membrane trafficking [BR:mcc04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    697393 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 3128 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESRRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSIPPPYHTTSQPNASVHQFPVPVGLPQQLLLQGSSRDSCNDSM
QSYDFDYPERRAIRQGSRAKDEKIRIISAFSDVDYEEQEDIHKEIEGKISQECLENNNIN
LKEAEVKEIRTLSKMDKYYSQQKQPKYKNRKKSPPQSQQTEFSTEFKVEASVFSRYPQKY
DTLDRRRKKKPLYNYFEDTERRHYDERSETKTNYKSTYSNTENCTLCHTENKKQIMGYPV
LYPYKNGFVVKSGLQRIKLESHDYHLCSCLRHCEKSSGSNQHVTNFTSLDILEDSTSSTS
DELLGSPISDKQENLQSPTWHSSIVHHLGDFPEEYYVANSALPLQRMNCDAKTLGDLSGC
STEEITPSSIEEPKEDHIDTMDELQCLVETVSEYLAEKEEEINRFGSLSKTKKSHKQNST
VDAEQRTPGDEIPPVTIVKNDKDMAISFPELTGVKCAVGSLFSSLTEKVGSGTKHLTNSV
EKLVSLVPEKAETLNKIEAINLGSKPRAMAVLEKDLSMQSPLSSQRDDNVNIGRHGKTSE
NEHMGNKTGSLYFENATESIAKDSSLQSQSSVIKSVFSRLNPLKIFSEKEETKKDDDQSK
PPRKESFVECGLELNKREGTLDNHSSSIIALNSSDEETTGWFQMPTSENLLSSQVTSEPS
NLASSASKNDDIESLLEGKPCIDVSVLPDQQKICAKDTPGHPCIAGSRTASKEVSSKPLE
EDKVTGNDDFLEPLRKSFSQFLLTSPETCSKESLSESVKIHQVEEDGLERGSKKDGRSFS
FSGKLNLPFFRGLGHSEKQQELKEKGSIFPLFKFSFTDSKVTVNDGSAVTTDEESKKNCH
EDTKHSSVKSSYVPNIHSDLGKFDSTEEFKKNDQINCPEDAKLNSIKSSSVPNIPDDLEK
FDSTKEFNKSDQVNCPEDAKLSSIKSSSVPNIHNNLGQFDSTEEFNQNDQRNSPEDAKFN
IIQSDSVTNINNDPGKFGSIEELNPSDHTAGENFERDGLAIPGVVPKKYITSDPLREGKS
LIQATSSVASDSSLECISATSKSTLVNEINEDKVIDKTSKKKTQGSFLSGLFNRFSSAEN
LSSQELNLKNDDSHHKNDTPGLISGIFNLLSNSSMTDHKPEEAKFVSLGNTKSLNGDMHL
SLDEVPATSCVTSENPKNYVEKHETSGFVEASLLPKENIPLSDAGVDNHHCSPTGKNQQS
EKHRPSSENTVLHCAPSAQLGFLYKSMAKRQMPNHVLEAKLHENSKKLNSPVLNTNILNK
SNNYQAFEEMNSPFCFEWDSDIKDLSKNSRKLQPVYYMLNQNRFPSADAFLWLDSENSVI
NFCQKDQNANILEWRTNPNSVIWCDLPYESFNQLAFNEDYLLRGDVWAANSLYGNSGPLP
INEANNSLEELPIDLSSSSDHEKTRCPIVDQKSLRMDENFVFSSFGYEYQEWLSCLEHGV
WWPSEDGDYGYYMFHDGQYIYSLLTDSTGQYAYLFIPDSYQDYLDCDLQTNGLSSIMLDN
SIISACSFKVLDEEDEILWYVEEEPIDDPLDLSLALPRSEEPLYLNLETFSQVLKESSYD
QSDQPLDFSGYNRQKFKGDFRSFKERPCGSEDPECTLDLRSQPQTISNHVLNRDQIIERD
KNQPLTKDSSVQLSSFHWLQPSVEEVASLVHPENMTKGSQQAEETSLVNKVTSVFSVLGA
SVGSTLNFDKSESLESLAMQKVSQQSDLAELTNDGFQSLIMSKQLEGNSPNEEKSLLKDS
ERQIVSNVQHPELTKNIRQEFSLNKNIHVKKQSLLKSGFQLSQTTPQAKLGVKDDEITTM
DSISVSPAPQHSRDEHENCELPQDQSSRESEETLFKTALKLFSRESSVSMTANEKQSSGF
LNLFKTQVNKEGSPNLEKTGDTNVKISPQEKKESSGVSNFWGTLGDFFKANVSPIQTTEN
MSVSSVTNKDEVRSSPTPIELASQGAGNFPAAPISSKGKARVRRLNKQTTIDDSRLKEPS
TRGIQGNDLTEKEVPFRDHLIQQSPNSSFSTSSLKESSRDSSVETSGVTTVTEASKSNEI
SLDTLSKRNSNEQYHFSDKDWSFSMATTSSPQPELPTKKSIFSFLTGSEKSENRASASLP
RAKSQAEGLFTLPSFFSTASSSIKKDTSHSSSTFSFFSLPFLDQNKETSGEKQSISTVVP
VTSQPCKKSNVFVDSGSTMTRESSSGHRDSIAQEVVHEQRMAPCISINNTVEVTSLADKL
SVEKRDCEEKLSSNTGPRTSVDFQMNELQKDIVPPSPEFQAQAETFLIGPENLGIVPHEE
EAFNHKAFPSDSLSNSFSLAKQLTEKFNDLESCTNYHQNEKFTTEPVNLPLEKAPDEVLP
QILGPASSSPEPGCAGNLQNQDADKEEDKSALGSSVDMLSGFVTKVKSFSGSLIEPPKTL
SGLFSSAKSPKKNSFFSLASDASSQPLKDELFGIFKSPKPESYKRESSLPATTWLQNGCS
RDAVGSAPPERREAAFTAPNSESTLSDCRMTVVSAKPESDILTDDPKLTTKMEDNNTPEN
ILELQRSETINTSSFSGDDTGQGVLSLSDEGDMGILQATDTEASLEAENIALPTQLQSDP
TCIAEELPPIQPPLPLEPEPAIQTASTNQDLLELHPASSLETDTTLFSDASVSQSTALET
EGRFSHPLLEDSVLPAKDSCEIIHAKKDPPAVPQETEHSRPRFEIPNVTSWPKLRLPSCA
TNHGKPLSSFFSSSLPSGNRAAETGLMSSFKKLSTFFEGNGEGKGSVPASDSKLGFGKVD
LSFPWPKENKWGPEQMPTESSPPVLVTSSDQDLYSSETNKALESSQISGASAQPDKVYTQ
PSGTSEQLAARPEVCARGLSGPGEGGNQQEISASGEHWDTKGNLCSPTCPSGKHEEEPST
VSEIFHQPEKQEEEAVPASTDSDLNVQQPVTLNDIMEPMTNKRPVLNSSIINGFKESTIY
DASDLVVD
NT seq 9387 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctctgcgtgcgcgttaaaagggccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtacagaatgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggaacaggatttcatgtttgagattagtcgcctggacctgggtcta
agtgtggaggtatggaacaaaggactgatctgggacaccatggtggggactgtgtggatt
gcactgaagactattcgtcagtcggatgaggaagggcctggggaatggtccacattggag
gcagagacgttaatgaaagatgatgagatctgtggaactagaaacccaactcctcataaa
attttgcttgatacaagatttgagttgccttttgatatcccagaggaggaagccagatat
tggacctacaaatgggagcaaatcaatgccttgggagctgacaatgagtattctagtcaa
gaagaaagccggaggaagccattgcccactgctgccgcccagtgttcttttgaagaccct
gatagtgccgtcgatgaccgagatagtgactatcgcagtgagaccagcaacagcatccca
cctccttaccatacaacttcccagcccaacgcttctgtgcaccagttccctgtgccggtg
ggattaccgcagcagctgctacttcaaggcagttcccgggactcttgtaatgattctatg
caaagttatgacttcgattatcctgagcggcgggccatcagacaaggctcacgggctaaa
gatgaaaaaattaggattatttcagccttctctgatgttgactatgaagagcaagaagat
atacataaggagatagaggggaaaatatcacaagagtgtctagaaaataataacataaac
ttgaaggaagcagaggtaaaagaaattagaaccctttcaaaaatggataaatactacagc
caacagaaacaaccaaagtataagaacaggaaaaagtcaccacctcagagccaacaaaca
gaattctctactgaatttaaggttgaagcatctgttttctccaggtatcctcaaaaatat
gatacactagatagacgaagaaaaaagaaacccttatacaattattttgaagacactgaa
agaagacattatgatgagagatctgaaactaagactaactacaaaagtacatattctaat
actgaaaattgtaccctttgccatactgaaaataagaaacaaattatggggtacccagtt
ttgtacccctacaaaaatggatttgtggttaagagtggcctgcagcgcattaagttggaa
agtcatgattatcatctgtgcagttgtttaagacactgtgaaaagtcatctggctcaaac
cagcatgtcactaattttacctcattagatattcttgaagattctactagtagtacttct
gatgaacttctgggttcccccatttctgataagcaggaaaatttacagtcaccaacatgg
cattcatccattgtccaccatcttggagattttcctgaagaatattatgtagcaaattca
gcattgccattacaaaggatgaattgtgatgcaaaaacacttggagatctgtctgggtgc
tctacagaagagataaccccttcctctattgaggagcccaaggaggaccatattgataca
atggatgagcttcagtgtttggtagaaactgtgtcagaatatttagcagagaaggaagaa
gagattaatagatttggttcactttcaaaaactaaaaaatcacataaacaaaatagtact
gttgatgcagaacagagaacgcctggggatgaaataccacctgtaactattgtcaagaat
gacaaggacatggccatctctttccctgagttgactggagtaaaatgtgctgttggttct
ttgtttagttcactcacagaaaaagtgggttcaggtacaaagcatctaacaaactctgtg
gaaaagttggtttccttagttccagaaaaagcagaaactcttaataaaatagaggcgatt
aatttgggatctaaacccagagccatggcagtattggaaaaggatctttccatgcaatct
ccattatcttctcaaagagatgataatgtgaatataggcagacatggaaaaacctctgaa
aatgagcacatgggcaataaaactgggagcttatactttgagaatgcaacagaaagtatt
gcaaaggactcgtctctacagagtcagagttcggttataaagtcggttttcagcaggtta
aatccattgaagatcttttcagaaaaggaggaaacaaaaaaagatgatgaccagagtaag
ccaccgagaaaagaaagctttgttgagtgtggtttggagttaaataaaagggaaggcact
cttgacaatcacagtagtagcatcattgcattaaatagtagtgatgaagaaactacgggc
tggttccagatgcccacaagtgagaatttgttgtcctcccaagtaactagtgaaccttca
aacttagctagttctgcaagtaaaaatgatgacattgagagtctattggagggaaaaccc
tgtatagatgtgtctgtgttaccagatcaacaaaaaatatgtgccaaagatactccagga
catccttgtatagctggcagtagaactgcaagtaaagaggtatcttcaaagccattagag
gaagacaaagttactggtaatgatgatttccttgagccactcagaaaatcatttagccag
tttttgctcacttcccctgagacttgttcaaaggaaagtttgtcagaatctgtgaaaatt
caccaggtggaggaagatggattggaaaggggctctaagaaagatggtcgttccttttcc
tttagtggaaaactaaatcttccattttttagaggtcttggtcattctgaaaagcaacag
gagttaaaagagaaaggaagcatttttcctttgtttaaattttctttcactgacagcaag
gttactgttaatgatggctcagcagtaaccactgatgaggagagcaaaaaaaattgccat
gaagataccaaacatagttcagtaaaatctagttatgttccaaatattcatagtgatcta
ggaaaatttgacagcacagaggaatttaaaaagaatgaccaaataaattgtcctgaagat
gccaaacttaattcaataaaatctagttcagttccaaatattcctgatgatctagagaag
tttgacagtacaaaggaatttaataagagtgaccaagtaaattgtcctgaagatgccaaa
cttagttcaataaaatctagttcagttccaaatattcataataatctagggcaatttgac
agtacagaggaatttaatcagaatgaccaaagaaatagtcctgaagatgccaaatttaat
ataatacagtctgattcagttacaaatattaataatgatccggggaaatttgggagtata
gaggaattaaatccaagtgaccacacagcaggagagaattttgaaagagatggattagcc
atccctggagttgtgcccaaaaaatatataacttcagatcctttaagagaaggtaagagt
ctaatacaagcaacatcttcagtagcatcagactcttcattagagtgtatttctgccact
tcgaaatccactttggttaatgaaattaatgaagataaggttatagataagacttccaag
aaaaaaacccaaggaagcttcctttctggcctgtttaataggttttcttctgctgaaaat
ttgtctagtcaagaattaaatttgaaaaatgatgactcccatcacaagaatgatacccca
ggtttaatctctggaatatttaacctgctatcaaatagcagtatgactgatcataaaccg
gaggaagcaaagttcgtgtctttaggcaacacgaagagtttgaatggagatatgcattta
tctttggatgaggtccctgctacttcatgtgtgacgtctgagaacccgaagaactatgtt
gaaaaacatgaaacttctggcttcgtagaagcctccttgttacctaaagaaaacatacca
ttatctgatgctggggttgataatcatcattgttctcctacagggaaaaatcagcaaagt
gaaaagcatcgtccctcctctgagaatactgtacttcactgtgctccaagtgctcagcta
ggttttttgtataaatctatggctaagaggcaaatgccaaaccatgttcttgaggcaaaa
ctacatgaaaattcaaagaagttaaattcacctgtactaaatactaacattctcaataaa
tcaaacaattatcaggcttttgaagagatgaacagtcctttctgttttgaatgggactct
gacataaaagatttgtctaaaaattccagaaaacttcagccagtttattatatgttaaat
caaaatagatttccatcagcagatgctttcttgtggcttgactcagaaaactcagtgata
aatttttgccaaaaagatcaaaatgcaaatatcttggagtggagaacaaatccaaacagt
gtcatttggtgtgacttaccatatgaatcattcaatcagttagcatttaatgaagattac
ttattaagaggtgatgtgtgggcagctaactcattatatggaaactctggtcctcttcca
attaatgaggctaataattcactagaagaattaccgattgacttaagttcttcatcagat
catgaaaagactagatgccccatagttgatcaaaaatcattaaggatggatgaaaatttt
gttttttcaagttttggttatgagtaccaggaatggttgtcatgtcttgaacatggagtg
tggtggccatcagaggatggggattatggatattatatgtttcatgatggtcaatatatc
tattctcttctcactgattctactgggcagtatgcatatttatttatacctgattcttat
caagattatttggattgtgatttacagacaaatggtctatcaagtattatgttggataac
agcattatttctgcctgtagttttaaagtacttgatgaggaagacgaaatattgtggtat
gttgaagaggaaccaattgatgaccctcttgatttatctttagctttgccaagaagtgaa
gaacccttgtatctaaatttagaaaccttttcacaagtacttaaagagtcaagttatgac
caaagcgatcagccactagatttttcaggctataatcgtcaaaagtttaaaggagatttt
agatctttcaaggaaaggccatgtggttctgaagatcctgaatgtacattagatctcaga
agtcagccccaaactattagtaatcatgtcttaaacagagatcaaattatagagagagat
aaaaaccaacctctaactaaagattcatcagttcagctttccagtttccattggcttcag
ccttctgttgaagaagttgcctctttggttcatcctgaaaatatgactaaaggctcacaa
caagcggaagagacatcattagtgaacaaagtgacttcagtattttctgttttgggtgcc
tcagttggaagtactttgaattttgataagagtgaatccttagagtctttggccatgcag
aaagtcagtcagcagtcagatttagcagagctcacaaatgatggctttcagtcattaatc
atgagtaagcaattagagggtaactccccaaatgaggaaaaaagtcttctcaaggattca
gaaagacagatagtatccaatgttcagcatccagaattgaccaaaaatataaggcaagaa
ttctctttaaataaaaacattcatgtgaaaaagcaaagtttgttaaaatctggtttccag
ttaagccaaacaactcctcaggctaaattaggtgtaaaagatgacgaaatcactacaatg
gactctatttcagtttctcctgcacctcagcatagtagggatgagcatgagaattgtgag
cttccccaggaccagtcgtccagagagtctgaggaaacattatttaaaactgcattgaaa
ctcttcagtagagaatcttcagttagtatgacagcaaatgaaaaacagtcatctggattt
ttgaacctttttaaaactcaggtgaataaagaaggatcaccaaacttagaaaagactggt
gatacaaatgtcaagatatcacctcaggaaaagaaagaatcttctggtgtttcaaatttt
tggggtacccttggggatttctttaaagccaatgtatcgcctatacagacaactgaaaat
atgtctgtttcttcagtgactaataaggatgaggtcaggtcaagtcctactcctatagag
ctagctagccagggtgctgggaactttcctgctgcaccaatttcctctaaagggaaggct
agagttagaagactgaacaaacagactactattgatgacagtaggttaaaggaaccatca
actagagggatccagggtaatgatttgactgaaaaagaggtaccattcagagaccaccta
atccagcagtcacctaattcatctttttcaacaagtagtctcaaagagtcttccagggat
tcttcagtagaaactagtggtgtgactacagtgacagaagcttcaaaaagtaatgaaata
tccttggataccctgagcaagagaaattcaaatgaacaatatcatttttctgacaaagac
tggagtttctccatggctacaacatcttcacctcaaccagagttaccaaccaaaaagagt
atattttcttttctgactggatctgaaaaatctgagaacagagcctctgctagtctacca
agagccaaatctcaagcagaagggctattcacacttccttcctttttttccactgctagc
tcaagcattaagaaggatacctctcatagtagctctacttttagtttcttcagcttgccc
tttttggatcaaaataaggagacctctggggaaaaacaaagcatttcaactgttgttcca
gtgacctcccagccctgtaagaagtcaaatgtttttgtagacagtggtagcacaatgacc
agagaaagttccagtggtcatagagatagcatagcccaagaagtagttcatgaacagcga
atggcaccttgtatttccattaacaacacagttgaggttacctcccttgcagataagctc
agtgtagagaagagggactgtgaggaaaaactgagttccaatactggaccacgaacatca
gtggatttccagatgaatgagttgcaaaaagacattgttcctccttcaccagaatttcag
gcacaggctgaaacattcctcattggcccagagaaccttgggatagttccccatgaagaa
gaggctttcaaccacaaagccttccccagtgactcactgtccaactctttttcacttgct
aaacagttaactgaaaaattcaatgacttagagagttgtacgaactaccaccaaaatgag
aaatttactactgaaccagtgaacttgccattagaaaaggcccccgatgaggtcttacca
cagatcctggggccagcctcttcctctccggagccagggtgtgcagggaaccttcagaac
caagatgcagataaagaggaagacaaatctgcattgggatcttcagtagacatgctttca
gggtttgtgaccaaagtgaaatctttctctgggagcttaattgaacctcccaaaacactc
tctggacttttctcctctgctaaatctccaaagaaaaactcctttttctctcttgcttct
gatgcatcatctcagcccctcaaagatgaattatttggaattttcaaaagtcccaagcca
gagtcatacaaacgagaatcatctctcccagctactacatggcttcagaatggttgttcc
agagatgctgtaggatcagcacctccagaaaggagagaagctgcctttacagcacccaat
tcagaatctactctcagtgactgtagaatgactgtggttagtgcaaagccagaatcagat
atcttgacagatgatcctaagctaacaaccaaaatggaagacaataatactcctgaaaat
attctggaacttcaacgttctgaaacaattaatacatcttctttctcaggcgatgatact
gggcaaggagtattgtctctgagtgatgaaggagacatggggatattgcaagctacagac
acagaggcatcattagaagcagagaacattgcgctgccaacacagttgcaatcagatcct
acctgcattgccgaagagcttcctccaattcagccacctcttcctcttgagccagagcca
gctattcaaactgcctccacaaaccaagacttactggagctgcatccagccagttcacta
gaaactgatactacactgttcagtgatgcaagtgtgagccagagcaccgcactggaaacc
gaagggcgcttttctcatcctctgctggaggactctgtgcttcctgccaaagacagttgt
gagataattcatgccaagaaagatccacctgcagtcccccaggaaacagagcattcaaga
ccacgttttgagatcccaaatgtgaccagttggccaaagcttcgtttgccatcctgtgct
actaaccacgggaaaccactgagctctttcttttcctcatctctcccctctggcaataga
gcagcagagactggtttaatgtccagttttaagaagttgtcaactttctttgagggaaat
ggtgaggggaaaggaagtgtaccagcaagtgattcaaaactagggtttggaaaggtggat
ctttcatttccgtggccaaaagagaacaaatggggccctgagcaaatgcctacagaatct
tcccctccggttttagttactagtagtgatcaggacctttactccagtgagactaacaaa
gctttggagtcttctcagatatctggggccagtgctcagccagataaagtctacactcag
ccctctgggacctctgagcagctggcggccaggccagaggtctgtgctcgggggctttca
ggacctggagaagggggaaaccagcaggaaatctcagcatccggagaacactgggatacc
aaaggcaacctctgtagccccacctgtccttcagggaaacatgaggaagaaccctccact
gtctctgagatatttcaccagccagaaaaacaggaagaggaggcagtgcctgctagtact
gactctgatttgaatgtacagcagccagtcactctgaatgacatcatggagccaatgacc
aacaaaaggcctgttcttaactcaagcatcataaatggctttaaagaatcgaccatttat
gatgcaagtgacttagtggtagattaa

DBGET integrated database retrieval system