KEGG   Macaca mulatta (rhesus monkey): 697532Help
Entry
697532            CDS       T01028                                 

Gene name
CLOCK
Definition
(RefSeq) clock circadian regulator
  KO
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    697532 (CLOCK)
  Environmental adaptation
   04710 Circadian rhythm
    697532 (CLOCK)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    697532 (CLOCK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     697532 (CLOCK)
Transcription factors [BR:mcc03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    697532 (CLOCK)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    697532 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 850 aa AA seqDB search
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSSTSTQSQQNVLSGHSQQTSLPSQTQSTLTA
PLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVA
CGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQQQQSSQEQQLTSVQQPSQA
QLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFSQSHHQQHQSQQQQQLSRHRTDS
LPDPSKVQPQ
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatccactgttctgcagaaaagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgaaagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
accccagaatacttaaaatcaaaaaatcagttagaattctgttgtcatatgctccgagga
acaatagacccaaaggagccatctacctatgaatatgtaaagtttataggaaatttcaaa
tctttaaacagtgtatcctcttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccgtcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatcaagacat
agtttagaatggaaatttctgtttctagatcacagggcaccacctataataggatatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagagaat
ttggcgaaatgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctgactaaagggcaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtcagacaatcgtataaacacagtcagtctcaaggaagca
ttggaaaggtttgatcatagcccaaccccttctgcctcttctcggagttcaagaaaatca
tctcacacagcagtctcagacccttcctcaacaccaaccaagatcccaacagatacgagc
actccgcccaggcagcatttaccagctcatgagaagatggtgcaaagaaggtcatcattt
agtagtcagtccataaattcccagtctgttggttcatcattaacacagccagtgatgtct
caagctacaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcaatta
ggagccatgcaacatctgaaagaccagttggaacaacggacacgcatgatagaagcaaat
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcagatggtccatggc
caggggctgcagatgtttttgcagcaatcaaatcctgggttgaattttggttctgttcaa
ctttcttctggaaattcatctaacatccagcaacttgcacctataaatatgcaaggccaa
gttgttcctactaaccagattcaaagtggaatgaatactggacacattggcacaactcag
cacatgatacaacaacagactttacagagtagtacatcaactcagagtcaacaaaatgta
ctgagtgggcacagtcagcaaacatctctacccagtcagacacagagcactcttacagcc
ccactgtataacactatggtgatttctcagcctgcagccggaagcatggtccagattcca
tctagtatgccacaaaacagcacccagagtgctgcagtaactacattcactcaggacagg
cagataagattttctcaaggtcaacaacttgtgaccaaattagtgactgctcctgtagct
tgtggggcagtcatggtacctagtactatgctcatgggccaggtggtgactgcatatcct
acttttgctacacaacagcaacagtcacagacattgtcagtaacacagcagcagcagcag
cagcagcagcagagctcccaggagcagcagctcacttcagttcagcaaccatctcaggct
cagctgacccaaccaccgcaacagtttttacagacttctaggttgctccatgggaatccc
tcaactcagctcatcctctctgctgcatttcctctacaacagagcaccttctctcagtca
catcaccagcaacatcagtctcagcaacagcagcaactcagccggcacaggactgacagt
ttgcccgacccttccaaggttcaaccacagtag

DBGET integrated database retrieval system