KEGG   Macaca mulatta (rhesus monkey): 697772Help
Entry
697772            CDS       T01028                                 

Gene name
PDK1
Definition
(RefSeq) pyruvate dehydrogenase kinase, isozyme 1
  KO
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
HIF-1 signaling pathway
Axon guidance
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    697772 (PDK1)
 Organismal Systems
  Development
   04360 Axon guidance
    697772 (PDK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    697772 (PDK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     697772 (PDK1)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   697772 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 436 aa AA seqDB search
MRLARLLRGAALPVPGPGLRAAGPSRSFSSDSGSGPAPERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKDGYENARRLC
DLYYINSPELELGELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP
IQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLP
ISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW
CVPSREPKDMTTFRSA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgcttcgcggagctgccttgcccgtcccgggcccggggctgcgc
gccgccggccccagccgctccttcagctcggactcgggctccggcccggcgcccgagcgc
ggcgttccgggccaggtggacttctacgcgcgcttctcaccgtccccgctctccatgaag
cagttcctggacttcggatcagtgaatgcttgtgaaaagacctcatttatgtttcttcgg
caagagttgcctgtcagactggcaaatataatgaaagaaataagtctccttccagataat
cttctcagaacaccatccgttcaattggtacaaagctggtatatccagagtcttcaggag
cttcttgattttaaggacaaaagtgctgaggatgctaaagctatttatgactttacagat
actgtgatacggatcagaaaccgacacaatgatgtcattcccacaatggcccagggtgtg
attgaatacaaggagagctttggggtggatcctgtcaccagccagaatgttcagtacttt
ttggatcgattctacatgagtcgcatttcaattagaatgttactcaatcagcactcttta
ttgtttgggggaaaaggcaaaggaagtccgtctcatcgaaaacacattggaagcataaat
ccaaactgcaatgtagttgaagttattaaagatggctatgaaaatgctaggcgtctgtgt
gatttgtattatattaactctcccgaactagaacttggagaactaaatgcaaaatcacca
ggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgtttgaactt
ttcaagaatgcaatgagagccactatggaacaccatgccaacagaggtgtttaccctcct
attcaagttcatgtcacgttgggtaatgaggatttgactgtgaagatgagtgaccgagga
ggtggtgttcctctgaggaaaattgacagactcttcaactacatgtattcaactgcaccg
agacctcgtgttgagacttcccgcgcggtgcccctggctggttttggttatggattgccc
atatcacgtctttacgcacaatacttccaaggagacctgaagttgtattccctagagggt
tacgggacagatgcagttatctacattaaggctttgtcaacagactcaatagaaagactc
ccagtgtataacaaagctgcctggaagcattacaacaccaaccacgaggctgatgactgg
tgcgtccccagcagagaacccaaagacatgacgacgttccgcagtgcctag

DBGET integrated database retrieval system