KEGG   Macaca mulatta (rhesus monkey): 698057Help
Entry
698057            CDS       T01028                                 

Definition
baculoviral IAP repeat-containing protein 4-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    698057
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    698057
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    698057
  Cell communication
   04510 Focal adhesion
    698057
 Human Diseases
  Cancers
   05200 Pathways in cancer
    698057
   05222 Small cell lung cancer
    698057
  Infectious diseases
   05166 HTLV-I infection
    698057
   05145 Toxoplasmosis
    698057
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    698057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 194 aa AA seqDB search
MIIHQKSWRLFQKFYADITQLLRCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLT
RRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSTQ
DESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPM
CYTVITFKQKIFMS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgataattcatcaaaagtcatggagactattccaaaagttttatgcagatataactcag
ctgttgaggtgtaaatatctgttagaacagaagggacaagaatatataaacaatattcat
ttaacccattcacttgaggaatgtctggtaagaactactgagaaaacaccatcactaact
agaagaattgatgataccatcttccaaaatcctatggtacaagaagctatacgaatgggg
ttcagtttcaaggacattaagaaaataatggaggaaaaaattcagatatctgggagcaac
tataaatcacttgaggttctggttgcagatctagtgaatgctcagaaagacagtacgcaa
gatgagtcaagtcagacttcattacagaaagagattagtactgaagagcagctaaggcgc
ctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctatcgtttttgtt
ccttgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaagtgtcccatg
tgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system