KEGG   Macaca mulatta (rhesus monkey): 698190Help
Entry
698190            CDS       T01028                                 

Gene name
AURKA
Definition
aurora kinase A
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mcc04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 347 aa AA seqDB search
MDRSKENCISGPVKPAAPVGGPKRVLVTQQFPCQNPLPANSGQAQRVLCPSNSSQRVPLQ
AQKLVSSHKLVQNQKQKQLQATSVPHPVSRPPSHTPKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVRCN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatctaaagaaaactgcatttcagggcctgttaagcctgcagctccagttgga
ggtccaaaacgtgttctcgtgactcagcaatttccttgtcagaatccattacctgcaaat
agtggccaggctcagcgggtcctgtgtccttcaaattcttcccagcgtgttcctttgcaa
gcacaaaagcttgtttccagtcacaaactggttcagaatcagaagcagaagcaattgcag
gcaaccagtgtacctcatcctgtctccaggccaccgagtcataccccaaagagcaagcag
cccctgccgtcggcacctgaaaataatcctgaggaggaactggcatcaaaacagaaaaat
gaagaatcaaaaaagaggcagtgggctttggaagactttgaaattggtcgccctctgggt
aaaggaaagtttggtaatgtttatttggcaagagaaaaacaaagcaagtttattctggct
cttaaagtgttatttaaagctcagctggagaaagccggagtggagcatcagctcagaaga
gaagtggaaatacagtcccaccttcggcatcctaatattctcagactgtatggttatttc
catgatgctaccagagtctacctaattctggaatatgcaccacttggaacagtctataga
gaacttcagaaactttcaaagtttgatgagcagagaactgctacgtatataacagaattg
gcaaatgccttgtcttactgtcattcgaagagagttattcatagagacattaagccagag
aacttacttcttggatcagctggagagcttaaaattgcagattttgggtggtcagtacat
gctccatcttccaggaggaccactctctgtggcaccctggactacctgccccctgaaatg
attgaaggtcggatgcatgatgagaaggtggatctctggagccttggagttctttgctat
gagtttttagttgggaagcctccttttgaggcaaacacataccaagagacctataaaaga
atatcccgggtaagatgcaactga

DBGET integrated database retrieval system