KEGG   Macaca mulatta (rhesus monkey): 698190Help
Entry
698190            CDS       T01028                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    698190 (AURKA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     698190 (AURKA)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   698190 (AURKA)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     698190 (AURKA)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    698190 (AURKA)
   Spindle formation proteins
    698190 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    698190 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 398 aa AA seqDB search
MDRSKENCISGPVKPAAPVGGPKRVLVTQQFPCQNPLPANSGQAQRVLCPSNSSQRVPLQ
AQKLVSSHKLVQNQKQKQLQATSVPHPVSRPPSHTPKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI
SRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNRVN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatctaaagaaaactgcatttcagggcctgttaagcctgcagctccagttgga
ggtccaaaacgtgttctcgtgactcagcaatttccttgtcagaatccattacctgcaaat
agtggccaggctcagcgggtcctgtgtccttcaaattcttcccagcgtgttcctttgcaa
gcacaaaagcttgtttccagtcacaaactggttcagaatcagaagcagaagcaattgcag
gcaaccagtgtacctcatcctgtctccaggccaccgagtcataccccaaagagcaagcag
cccctgccgtcggcacctgaaaataatcctgaggaggaactggcatcaaaacagaaaaat
gaagaatcaaaaaagaggcagtgggctttggaagactttgaaattggtcgccctctgggt
aaaggaaagtttggtaatgtttatttggcaagagaaaaacaaagcaagtttattctggct
cttaaagtgttatttaaagctcagctggagaaagccggagtggagcatcagctcagaaga
gaagtggaaatacagtcccaccttcggcatcctaatattctcagactgtatggttatttc
catgatgctaccagagtctacctaattctggaatatgcaccacttggaacagtctataga
gaacttcagaaactttcaaagtttgatgagcagagaactgctacgtatataacagaattg
gcaaatgccttgtcttactgtcattcgaagagagttattcatagagacattaagccagag
aacttacttcttggatcagctggagagcttaaaattgcagattttgggtggtcagtacat
gctccatcttccaggaggaccactctctgtggcaccctggactacctgccccctgaaatg
attgaaggtcggatgcatgatgagaaggtggatctctggagccttggagttctttgctat
gagtttttagttgggaagcctccttttgaggcaaacacataccaagagacctataaaaga
atatcccgggttgaattcacattccctgattttgtaacagagggagccagggacctcatt
tcaagactgttgaagcataatcccagccagaggccaatgctcagagaagtacttgaacac
ccctggatcacagcaaattcatcaaaaccatcaaattgccaaaacagagtcaactag

DBGET integrated database retrieval system