KEGG   Macaca mulatta (rhesus monkey): 698225Help
Entry
698225            CDS       T01028                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01100  Metabolic pathways
mcc01524  Platinum drug resistance
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc05010  Alzheimer's disease
mcc05012  Parkinson's disease
mcc05014  Amyotrophic lateral sclerosis (ALS)
mcc05016  Huntington's disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05164  Influenza A
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05222  Small cell lung cancer
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    698225
   04215 Apoptosis - multiple species
    698225
   04115 p53 signaling pathway
    698225
 Human Diseases
  Cancers
   05200 Pathways in cancer
    698225
   05210 Colorectal cancer
    698225
   05222 Small cell lung cancer
    698225
  Neurodegenerative diseases
   05010 Alzheimer's disease
    698225
   05012 Parkinson's disease
    698225
   05014 Amyotrophic lateral sclerosis (ALS)
    698225
   05016 Huntington's disease
    698225
  Cardiovascular diseases
   05416 Viral myocarditis
    698225
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    698225
  Infectious diseases
   05134 Legionellosis
    698225
   05152 Tuberculosis
    698225
   05164 Influenza A
    698225
   05161 Hepatitis B
    698225
   05168 Herpes simplex infection
    698225
   05167 Kaposi's sarcoma-associated herpesvirus infection
    698225
   05145 Toxoplasmosis
    698225
  Drug resistance
   01524 Platinum drug resistance
    698225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 698225
NCBI-ProteinID: XP_001088492
Ensembl: ENSMMUG00000032513
UniProt: G1K372
Position
18
AA seq 105 aa AA seqDB search
MGNVEKGKKIFTMKCSQCHTVEKGGKHQTGPNLHGLFGRKTVQAPGYSYTAANENKGITW
GEDTLMEYLENPKKCLPGTKMIFVGIKKKEERADLIAYLKEATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgttgagaaaggcaagaagatttttactatgaagtgttcccagtgccacacc
gttgaaaagggaggcaaacaccagactgggccaaatcttcatggtctcttcgggcggaag
acagttcaggcccctggatactcttacacagccgccaatgagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtgcctccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
gaagctactaatgagtaa

DBGET integrated database retrieval system