KEGG   Macaca mulatta (rhesus monkey): 698225Help
Entry
698225            CDS       T01028                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    698225
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    698225
   04115 p53 signaling pathway
    698225
 Human Diseases
  Cancers
   05200 Pathways in cancer
    698225
   05210 Colorectal cancer
    698225
   05222 Small cell lung cancer
    698225
  Neurodegenerative diseases
   05010 Alzheimer's disease
    698225
   05012 Parkinson's disease
    698225
   05014 Amyotrophic lateral sclerosis (ALS)
    698225
   05016 Huntington's disease
    698225
  Cardiovascular diseases
   05416 Viral myocarditis
    698225
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    698225
  Infectious diseases
   05134 Legionellosis
    698225
   05152 Tuberculosis
    698225
   05164 Influenza A
    698225
   05161 Hepatitis B
    698225
   05168 Herpes simplex infection
    698225
   05145 Toxoplasmosis
    698225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 105 aa AA seqDB search
MGNVEKGKKIFTMKCSQCHTVEKGGKHQTGPNLHGLFGRKTVQAPGYSYTAANENKGITW
GEDTLMEYLENPKKCLPGTKMIFVGIKKKEERADLIAYLKEATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgttgagaaaggcaagaagatttttactatgaagtgttcccagtgccacacc
gttgaaaagggaggcaaacaccagactgggccaaatcttcatggtctcttcgggcggaag
acagttcaggcccctggatactcttacacagccgccaatgagaacaaaggcatcacctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtgcctccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttgatagcttatctcaaa
gaagctactaatgagtaa

DBGET integrated database retrieval system