KEGG   Macaca mulatta (rhesus monkey): 698283Help
Entry
698283            CDS       T01028                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:mcc04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mcc04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mcc05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mcc05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 858 aa AA seqDB search
MTERRPPPTGAGVRGSDGGPRRGEVASRCLGSSPLPPPSSPPSPTPRDWPRPLAGEHPSL
PVSHWEELGARSRGGEDSRTPGALGKRRGGKRGVRRWAEPEARVLWRLTPSAGGGGAAAR
SDSPVIIAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVS
EEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKP
PFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDD
ISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKL
PLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVISPPPVAGTI
SYNSTSSSLEQSNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKRPRVMGDIPMELI
NEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMW
LVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFC
AVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYV
GYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDG
VRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKR
TEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCAN
ILEKFFFSKIKEAGLIDK
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaggcggccccctcccactggtgcgggcgtgcgggggtcggatggggggccg
cggaggggggaggtggccagcaggtgcctgggatccagtcccctacccccaccctcgtcc
ccaccctcacccacacccagggattggcctcgccccctggcgggcgagcatccatccctt
cccgtgtcccactgggaggaactgggtgcaaggagtcggggtggagaagactcccggact
cctggcgctttgggaaagcgaaggggaggaaagcgcggggtgcgaaggtgggcagagccc
gaggcgagggtcttgtggcgcctgacgccctcggctgggggcggaggcgctgccgcgcgc
agtgacagccctgtcattattgccgaggagtcttgcaaatgtaatggctggaaaaaccct
aacccgtcacccactccccccagagccgatctgcagcaaataattgtcagtctgacggaa
tcctgtcggagttgtagccatgccctagctgctcatgtttcccacctggagaatgtgtca
gaggaagaaatgaacagactcctgggaatagtattggatgtggaatatctctttacctgt
gtccacaaggaagaagatgcagataccaaacaagtttatttctacctatttaagctcttg
agaaagtctattttacaaagaggaaaacctgtggttgaaggctctttggaaaagaaaccc
ccatttgaaaaacctagcattgaacagggtgtgaataactttgtacagtacaaatttagt
cacctgccagcaaaagaaaggcaaacaatagttgagttggcaaaaatgttcctaaaccgc
atcaactattggcatctggaggcaccatctcaacgaagactgcgatctcccaatgatgat
atctccggatacaaagagaactacacaaggtggctgtgttactgcaacgtgccacagttc
tgcgacagtctacctcggtacgaaaccacacaggtgtttgggagaacattgcttcgctcg
gtcttcaccgtcatgaggcgacaactcctggaacaagcaagacaggaaaaagataaactg
cctcttgaaaaacgaactctaatcctcacccatttcccaaaatttctgtccatgctagaa
gaagaagtttatagtcaaaactctcccatttgggatcaggattttctctcagcctcgtcc
agaaccagccagctaggcatccaaacagttatcagtccacctcctgtggctgggacaatt
tcatacaattcaacctcatcttcccttgagcagtcaaatgcagggagcagcagtcctgcc
tgcaaagcctcttctggacttgaggcaaacccaggagaaaagaggaaaatgactgattct
catgttctggaggaggccaagagaccccgagttatgggggatattccgatggaattaatc
aacgaggttatgtctaccatcacggaccctgcagcgatgcttggaccagagaccaatttt
ctgtcggcacactcggccagggatgaggcggcaaggttggaagagcgcaggggtgtaatt
gaatttcacgtcgttggcaattccctcaaccagaaaccaaacaagaagatcctcatgtgg
ctggttggcctacagaacgttttctcccaccagctgccccgaatgccaaaagagtacatc
acacggctcgtctttgacccgaaacacaaaacccttgctttaattaaagatggccgtgtt
attggtggtatctgtttccgtatgttcccatctcaaggattcacagagattgtcttctgt
gctgtaacctccaacgagcaagtcaagggctatggaacacacctaatgaatcatttgaaa
gaatatcacataaagcatgacatcctgaacttcctcacatatgcagatgaatatgcaatt
ggatactttaagaaacagggcttctccaaagaaattaaaatacctaaaaccaaatatgtt
ggctacatcaaggattatgaaggagccactttaatggggtgtgagctaaatccacggatc
ccatacacagaattttctgtcatcattaaaaagcagaaggagataattaaaaaactgatt
gaaagaaaacaggcacagattcgaaaagtttaccctggactttcatgttttaaagatgga
gttcgacagattcctatagaaagcattcctggaattagagagacaggctggaaaccgagt
ggaaaagagaaaagtaaagagcccagagaccctgaccagctttacagcacgctcaagagc
atcctccagcaggtgaagagccatcaaagcgcttggcccttcatggaacctgtgaagaga
acagaagctccgggatattatgaagttataaggttccccatggatctgaaaaccatgagt
gaacgcctcaagaataggtactacgtgtctaagaaattattcatggcagacttacagcga
gtctttaccaattgcaaagagtacaacccccctgagagtgaatactacaaatgtgccaat
atcctggagaaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system