KEGG   Macaca mulatta (rhesus monkey): 698481Help
Entry
698481            CDS       T01028                                 

Gene name
EIF3B, EIF3S9
Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    698481 (EIF3B)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     698481 (EIF3B)
Translation factors [BR:mcc03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    698481 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 814 aa AA seqDB search
MQDAENVAVPEAAEERAEPGQQQPAAEPPPDEGLLRPAGPGAPEAAGTEASSEEVAVAEA
GPEPEVRTEPAAEAEAAFGPSESLSPPAAEEPPGSHAEPPVPAQGEAPGERARDECADSR
AQAASEDAGGNEGSAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA
DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP
AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW
GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA
FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV
VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD
PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI
KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG
GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcagagaacgtggcggtgcccgaggcggccgaagagcgtgccgagcccggc
cagcagcaaccggccgccgagccgccgccagacgaggggctgctgcggcccgcagggccc
ggcgctccggaggcggcagggacagaggcctctagtgaggaggtggcggtcgcggaggcc
gggccggagccggaggtgaggaccgagccggcggccgaggcagaggcggccttcggcccg
tccgagtcgctctcgcctccggcagccgaggaacctcctgggtcgcacgctgagccccct
gtcccggcacagggcgaggccccgggagagcgggctcgggacgagtgcgccgacagccgg
gcccaggcggcgtccgaggacgcgggaggaaacgagggcagcgcggccgaggccgagccc
cgggcgctggagaacggcgacgcggacgagccctccttcagcgaccccgaggacttcgtg
gacgacgtgagcgaggaagaattactgggagatgtcctcaaagaccggccccaggaagcg
gacggaatcgattcggtgattgtagtggacaacgtccctcaggtgggacctgaccgactt
gagaagctcaaaaatgtcatccacaagatcttttccaagtttgggaaaatcacaaatgat
ttttatcctgaagaggatgggaagacgaaagggtatattttcctggagtacgcgtccccg
gcccacgctgtggatgctgtgaagaacgccgacggctacaagcttgacaagcagcacacg
ttccgggtcaacctcttcacagattttgacaagtatatgaccatcagtgacgagtgggat
attccagagaaacagcctttcaaagacctggggaacttacgttactggcttgaagaggca
gaatgcagagatcagtacagtgtgatttttgagagtggagaccgcacttccatattctgg
aatgacgtaaaagaccctgtctcaattgaagaaagagcgagatggacagagacatatgtg
cgttggtctcctaagggcacctatctggctacctttcatcaaagaggcattgctctatgg
gggggagagaaattcaagcaaattcagagattcagccaccaaggggttcagctcattgac
ttctcaccttgtgaaaggtacctggtgacctttagccccctgatggacacgcaggatgac
cctcaggccataatcatctgggacatccttacagggcacaagaagagaggttttcactgt
gagagctcagcccattggcctatttttaagtggagccacgatggcaaattctttgccaga
atgaccctggatacgcttagcatctatgaaactccttctatgggtcttttggacaagaag
agtttgaagatctctgggataaaagacttttcttggtctcctggtggtaacataatcgcc
ttctgggtgcctgaagacaaagatattccagccagggtaaccctgatgcagctccctacc
aggcaagagatccgcgtgaggaacctgttcaacgtggtggattgcaagctccactggcag
aagaacggagactacttgtgtgtgaaagtagataggactccgaaaggcacccagggtgtt
gtcacaaattttgaaattttccgaatgagggagaaacaggtacctgtggatgtggtcgaa
atgaaagaaaccatcatagcctttgcctgggaaccaaatggaagtaagtttgccgtgctg
catggagaggctccgcggatatctgtgtctttctaccacgtcaaaaacaacgggaaaatt
gaactcatcaagatgttcgacaagcagcaagcaaacaccatcttctggagcccccaagga
cagttcgtggtgttggcgggcctgaggagtatgaatggtgccttagcgtttgtggacact
tcggactgcacggtcatgaacatcgcagagcactacatggcttccgacgtcgagtgggat
cccaccggacgctacgtcgtcacctctgtgtcctggtggagccataaggtggacaatgca
tactggctgtggactttccagggccgccttctgcagaagaacaacaaggaccgcttctgc
cagctgctgtggcggccccggcctcccacactcctgagccaggagcagatcaagcaaatt
aaaaaggatctgaagaaatactcgaagatctttgaacagaaggatcgtttgagccagtcc
aaagcctcaaaggaattggtggagagaaggcgcaccatgatggaagacttccggaagtac
cgaaaaatggcccaggagctctatatggagcagaaaaacgagcgcctggagttgcgagga
ggtgtggacactgacgagctggacagcaacgtggacgactgggaagaggagaccatagag
ttcttcgtcactgaggaaatcatccctcttgggaaccaggagtga

DBGET integrated database retrieval system