KEGG   Macaca mulatta (rhesus monkey): 698604Help
Entry
698604            CDS       T01028                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04152  AMPK signaling pathway
mcc04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    698604 (EEF2K)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    698604 (EEF2K)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     698604 (EEF2K)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   698604 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase Sel1
Motif
Other DBs
NCBI-GeneID: 698604
NCBI-ProteinID: XP_001092565
Ensembl: ENSMMUG00000017725
UniProt: F7F8P2
Position
20
AA seq 725 aa AA seqDB search
MADEDLIFRLEGVDGGQSPRTGHDGDSDGDSDDEEGYFICPITDDPRSNQNVNSKVNKYY
SNLTKSERYGSSGSPANSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELRDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRDSENSGDSGYPSEKRGELDDPEPREHGHSNGNRKYESDEDSLGSCGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDRESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFYY
LLKAAEAGDRQSMILMARAFDTGQNLSPDRCRDWLEALHWYKTALEMTDCDEGGEYDGMQ
DEPRYTMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggtcagtccccccga
actggccatgatggtgattctgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcactgatgacccaaggtcgaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatggatccagtgggtccccggcaaactctttccac
ttcaaggaagcctggaagcacgcaatcgagaaggccaagcacatgcccgacccctgggct
gagttccacctagaagacattgccaccgaacgtgctactcgacacaggtacaacgctgtc
accggggaatggctggatgatgaagttctgatcaagatggcatctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaacttcctgcatgcccagcag
tggaagggagcctccaactacgtggcgaagcgctacatagagccggtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggggaggagtataaccgg
cacaagccccccaagcaggtggacatcatgcagatgtgcatcatcgagctgagggacaga
ccgggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaat
tccaactctggctttgtccgtgatgacaacatccgcctgacgccgcaggccttcagtcac
ttcacgtttgagcgttccggccatcagctgatagtggtggacatccagggagttggggat
ctctacactgacccacagatccacacagagacgggcactgactttggagacggcaaccta
ggtgtccgtgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcgccccgggagagggacgcggtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagatgagaacatgagcgatgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccacctccattggccagtgttcagtgacctcgataac
atggcatccagagaccatgatcatctagacaaccaccgggactctgagaatagtggggac
agtggataccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggc
cactcaaacggtaaccggaagtacgagtctgacgaagacagcctaggcagctgcggacgg
gtctgtgtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcg
gccgtggccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaag
tccattttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgc
gagaagggcgaggagtgggaccgggagtcggctgtcttccacctggagcacgcggccgac
ctgggcgagctggaggccatcgtgggcctgggactcatgtactcgcagctgccccatcac
atcctagctgacgtctctctgaaggagacagaagagaacaaaaccaaaggattttattat
ttactgaaggccgcagaagctggtgacaggcagtccatgatcctgatggcgcgagctttt
gacactggccagaacctcagcccagacaggtgccgagactggctggaggccctgcactgg
tacaaaactgccctggagatgacggactgtgatgagggtggtgagtacgacggaatgcag
gacgagccccggtacacgatgctggccagggaggctgaaatgctgttcacaggaggctat
gggctggagaaggacccgcagagatcaggggacttgtatacccaggcagcagaggcagcg
atggaagccatgaagggccggctggccaaccagtactaccaaaaggctgaagaggcctgg
gcccagatggaggagtaa

DBGET integrated database retrieval system