KEGG   Macaca mulatta (rhesus monkey): 698604Help
Entry
698604            CDS       T01028                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Oxytocin signaling pathway
Class
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:mcc04921]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 725 aa AA seqDB search
MADEDLIFRLEGVDGGQSPRTGHDGDSDGDSDDEEGYFICPITDDPRSNQNVNSKVNKYY
SNLTKSERYGSSGSPANSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELRDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRDSENSGDSGYPSEKRGELDDPEPREHGHSNGNRKYESDEDSLGSCGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDRESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFYY
LLKAAEAGDRQSMILMARAFDTGQNLSPDRCRDWLEALHWYKTALEMTDCDEGGEYDGMQ
DEPRYTMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggtcagtccccccga
actggccatgatggtgattctgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcactgatgacccaaggtcgaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatggatccagtgggtccccggcaaactctttccac
ttcaaggaagcctggaagcacgcaatcgagaaggccaagcacatgcccgacccctgggct
gagttccacctagaagacattgccaccgaacgtgctactcgacacaggtacaacgctgtc
accggggaatggctggatgatgaagttctgatcaagatggcatctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaacttcctgcatgcccagcag
tggaagggagcctccaactacgtggcgaagcgctacatagagccggtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggggaggagtataaccgg
cacaagccccccaagcaggtggacatcatgcagatgtgcatcatcgagctgagggacaga
ccgggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaat
tccaactctggctttgtccgtgatgacaacatccgcctgacgccgcaggccttcagtcac
ttcacgtttgagcgttccggccatcagctgatagtggtggacatccagggagttggggat
ctctacactgacccacagatccacacagagacgggcactgactttggagacggcaaccta
ggtgtccgtgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcgccccgggagagggacgcggtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagatgagaacatgagcgatgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccacctccattggccagtgttcagtgacctcgataac
atggcatccagagaccatgatcatctagacaaccaccgggactctgagaatagtggggac
agtggataccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggc
cactcaaacggtaaccggaagtacgagtctgacgaagacagcctaggcagctgcggacgg
gtctgtgtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcg
gccgtggccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaag
tccattttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgc
gagaagggcgaggagtgggaccgggagtcggctgtcttccacctggagcacgcggccgac
ctgggcgagctggaggccatcgtgggcctgggactcatgtactcgcagctgccccatcac
atcctagctgacgtctctctgaaggagacagaagagaacaaaaccaaaggattttattat
ttactgaaggccgcagaagctggtgacaggcagtccatgatcctgatggcgcgagctttt
gacactggccagaacctcagcccagacaggtgccgagactggctggaggccctgcactgg
tacaaaactgccctggagatgacggactgtgatgagggtggtgagtacgacggaatgcag
gacgagccccggtacacgatgctggccagggaggctgaaatgctgttcacaggaggctat
gggctggagaaggacccgcagagatcaggggacttgtatacccaggcagcagaggcagcg
atggaagccatgaagggccggctggccaaccagtactaccaaaaggctgaagaggcctgg
gcccagatggaggagtaa

DBGET integrated database retrieval system