KEGG   Macaca mulatta (rhesus monkey): 698767Help
Entry
698767            CDS       T01028                                 

Definition
histone H2B type W-T-like
Orthology
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mcc05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:mcc05322]
Human Diseases; Substance dependence; Alcoholism [PATH:mcc05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 175 aa AA seqDB search
MLHTQVSPLPRSTTAIVCSCHLMAAVSAMAGPSSEIISEEQLITQEPKEANSTTAQKHCK
QRKRGRRGPRRSHANCRRDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATE
AGRLARSTKRQTITDWEIRTAVRLLLPGEMGKLAESKGTKAVLRTSLYAIQQQRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatacccaagtgtccccgcttccccgttccacaaccgccattgtctgttcgtgt
catctaatggccgctgtctccgccatggctggaccttcctctgagattatctctgaggaa
cagctgatcacccaggagcccaaagaggccaactccaccacggcccagaagcattgcaag
cagaggaagcgagggcgacgtgggccccgcaggtcccacgccaactgccgcagggacagc
ttcgccacctatttccgccgggtgctgaagcaggttcaccagggcctcagcctttcccgg
gaggccgtgagtgtcatggattctttggttcatgacatactggaccgcatcgccaccgag
gctggtcgcctggcccgctccaccaagcgccagaccatcaccgactgggagatccggacc
gctgtgcgcctgctgctgccgggggagatgggcaagcttgccgagtccaaaggcacgaag
gctgtcctcagaacttcactatatgccatacagcagcagagaaagtga

DBGET integrated database retrieval system