KEGG   Macaca mulatta (rhesus monkey): 698767Help
Entry
698767            CDS       T01028                                 

Definition
(RefSeq) histone H2B type W-T-like
  KO
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    698767
  Immune diseases
   05322 Systemic lupus erythematosus
    698767
  Substance dependence
   05034 Alcoholism
    698767
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   698767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 175 aa AA seqDB search
MLHTQVSPLPRSTTAIVCSCHLMAAVSAMAGPSSEIISEEQLITQEPKEANSTTAQKHCK
QRKRGRRGPRRSHANCRRDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATE
AGRLARSTKRQTITDWEIRTAVRLLLPGEMGKLAESKGTKAVLRTSLYAIQQQRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatacccaagtgtccccgcttccccgttccacaaccgccattgtctgttcgtgt
catctaatggccgctgtctccgccatggctggaccttcctctgagattatctctgaggaa
cagctgatcacccaggagcccaaagaggccaactccaccacggcccagaagcattgcaag
cagaggaagcgagggcgacgtgggccccgcaggtcccacgccaactgccgcagggacagc
ttcgccacctatttccgccgggtgctgaagcaggttcaccagggcctcagcctttcccgg
gaggccgtgagtgtcatggattctttggttcatgacatactggaccgcatcgccaccgag
gctggtcgcctggcccgctccaccaagcgccagaccatcaccgactgggagatccggacc
gctgtgcgcctgctgctgccgggggagatgggcaagcttgccgagtccaaaggcacgaag
gctgtcctcagaacttcactatatgccatacagcagcagagaaagtga

DBGET integrated database retrieval system