KEGG   Macaca mulatta (rhesus monkey): 698921Help
Entry
698921            CDS       T01028                                 

Gene name
MOS
Definition
(RefSeq) v-mos Moloney murine sarcoma viral oncogene homolog
  KO
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    698921 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    698921 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    698921 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    698921 (MOS)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     698921 (MOS)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: Other group
  MOS family
   698921 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 346 aa AA seqDB search
MPSPLALRPYLPSEFSPSVDARPCSSPSELPAKLLLGATPPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYHGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCSTGGPLTLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPLYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFQDSLPGQRLGDVIRRCWRPSAAQRPSARLLLVDLTSLKAEFG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccccagcgagttttccccgtcggtggac
gcccggccctgcagcagtccctcagagctccctgcgaagctgcttctgggggccactcct
cctcgggccccgcggctgccgcgccggctggcttggtgctccattgactgggagcaggtg
tgcttgctgcagaggctgggagccggagggtttggctcggtgtacaaggcgacttaccac
ggtgttcctgtggccataaagcaagtgaacaagtgcactaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcggggtccaacagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctacggcgccgccggccaccctgagggg
gacgcgggggagcctcactgcagcactggaggaccgttaactttgggaaagtgtctcaag
tactccctagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaggatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgctgtgcttccagacacccctttacccccttgga
ggcacatacacccaccgcgccccggaactcctgaaaggagagggagtgacgcccaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccctattcg
ggggagcggcagcacatactgtacgcagtggtggcctacgacctgcgcccgtccctctcc
gctgccgtcttccaggactcgctccccgggcagcgccttggggacgtcatccggcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaattcggctga

DBGET integrated database retrieval system