KEGG   Macaca mulatta (rhesus monkey): 698930Help
Entry
698930            CDS       T01028                                 

Definition
histone H2B type F-M-like
Orthology
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    698930
  Immune diseases
   05322 Systemic lupus erythematosus
    698930
  Substance dependence
   05034 Alcoholism
    698930
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   698930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 177 aa AA seqDB search
RATRPNQSAPVPWSTTVTVWSCHLMAAASAMAEASSKMTSEEDQSIQEPKEANSATVQKK
TRGLRGSHRRHANRRRDSFGNSFAAYFPQVLKQVHQGLSLSPESVSVMDSMVHDILDRIA
TEAGRLARYAKRVTITSRDIQVAVRLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
agagccacgcggccaaaccaaagtgcccccgttccctggtccacaaccgtcactgtctgg
tcttgccatctaatggccgctgcctctgccatggctgaggcttcctctaagatgacctct
gaggaagaccagagcatccaagagcccaaagaggccaactccgcgaccgtccagaagaag
acgcgagggctccgaggttcccacaggcgccatgccaaccgccgcagggacagcttcggg
aacagctttgccgcctatttcccccaggtgctgaagcaggttcaccagggcctcagcctt
tccccggagtccgtgagtgtcatggactctatggtccatgacatattggaccgcatcgcc
accgaggctggtcgcctggcccgctacgccaagcgtgtgaccatcacctcccgggacatc
caggtggccgtgcgcctactgctgccggggaagatgggcaagctcgctgaggcccagggc
acgaatgccgccctcagaacttcattatgtgcgatatggcaacagagaaagtga

DBGET integrated database retrieval system