KEGG   Macaca mulatta (rhesus monkey): 699275Help
Entry
699275            CDS       T01028                                 

Gene name
H2BFWT
Definition
(RefSeq) H2B histone family, member W, testis-specific
  KO
K11252  histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05034  Alcoholism
mcc05203  Viral carcinogenesis
mcc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    699275 (H2BFWT)
  Immune diseases
   05322 Systemic lupus erythematosus
    699275 (H2BFWT)
  Substance dependence
   05034 Alcoholism
    699275 (H2BFWT)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    699275 (H2BFWT)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   699275 (H2BFWT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TAF
Motif
Other DBs
NCBI-GeneID: 699275
NCBI-ProteinID: NP_001180847
Ensembl: ENSMMUG00000032380
UniProt: F6U4G8
Position
X
AA seq 175 aa AA seqDB search
MLRTQVPPLLRSTTAIVWSCRVMAAASAMAEPSSETTSEEQLITQEPKEANSTMAQKQSK
QRKRGRRGPCRCHANCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATE
AGRLARSTKRQTITAWETRIAVRLLLPGEMGKLAESEGTKAVLRTSLYAVQQQRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtacccaagtgcccccgcttctccgatccacaaccgccattgtctggtcgtgc
cgtgtaatggccgctgcctccgccatggctgaaccttcctctgagacgacctctgaggag
cagctgatcacccaggagcccaaagaggccaactccacgatggcccaaaagcagagcaag
cagaggaagcgagggcgccgtgggccctgcaggtgtcacgccaactgccgcggggacagc
ttcgccacctatttccgccgggtgctgaagcaggttcaccagggcctcagcctttcccgg
gaggccgtgagtgtcatggattctttggtccatgacatactggaccgcatcgccaccgag
gctggtcgcctggcccgctccaccaagcgccagaccatcaccgcctgggagacccggatc
gctgtgcgcctgctgctgccgggggagatgggcaaactggcagagtccgaaggcacgaag
gctgtcctcagaacttcactatatgccgtacagcaacagagaaagtga

DBGET integrated database retrieval system