KEGG   Macaca mulatta (rhesus monkey): 699369Help
Entry
699369            CDS       T01028                                 

Gene name
PRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mcc04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mcc04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mcc04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mcc04060]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:mcc04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 619 aa AA seqDB search
MKENVISATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYVMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELTVEVKQPEDRKPYLWMKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
ETHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFIMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLIQ
HNPRSSYHNITDVCELAVGPADAPATLLDEAGKDALKSSQTIKSREEGKAAQQREVDSFH
SKTDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGQPEKPRAPENS
KEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEQDLANCTATPSKCR
IQLGGLDYLDPACFTHSFH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtgatatctgcaactgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctcctggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcctaccaattat
tcgctgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataact
ggtgggcccaactcctgccactttggcaagcagtacacctccatgtggaggacatacgtc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactctacgtggac
gtgacttacatagttcaaccagaccctcctttggagctgactgtggaagtaaaacagcca
gaagatagaaaaccctacctgtggatgaaatggtctccacctaccctgattgacttgaaa
actggttggttcacgctcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagacccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagatcatggatactggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcatcatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccaccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagacgacagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgcgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaattccctattttcatgctggcgggtccaaatgttcaacatggcccttaatacag
cacaaccccagatcctcctaccacaatattactgatgtgtgtgagctggctgtgggccct
gcagatgcaccggccactctgttggacgaagcaggtaaagatgctttaaaatcctctcaa
accattaagtctagagaggagggaaaggcagcccagcagagggaggtggatagcttccat
tccaagactgaccaagatacgccctggctgctgccccaggagaaaaccccctttggctcc
gctaaacccttggattatgtggagattcacaaggtcaacaaagatggcgcattatcattg
ctaccaaaacagagagagaacagcggccagcccgagaagcccagggctcctgagaacagt
aaggagtatgccaaagtgtccggggtcatggataacaacatcctggtgttggtgccggat
ccgcatgctaaaaatgtggcttgctttgaggaatcagccaaagaggccccaccatcactt
gaacagaatcaagctgagcaagacctggccaactgcactgcgacaccaagcaagtgcagg
atccagctgggtggtttggattacctggatcccgcatgttttacgcactcctttcattga

DBGET integrated database retrieval system