KEGG   Macaca mulatta (rhesus monkey): 699394Help
Entry
699394            CDS       T01028                                 

Gene name
PDK3
Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 3-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     699394 (PDK3)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   699394 (PDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 381 aa AA seqDB search
MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVXNRHN
DVVPTMAQGLINQHTLLFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLV
APELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLV
TLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLY
ARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSS
EPRDASKYKAKQDKIKTNRTF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgttccggtggctgctgaagcagccggtgcccaagcagatcgagcgctactcg
cgcttctcgccgtcgccgctctccatcaaacagttcctggacttcgggagagataatgca
tgtgagaaaacttcatatatgtttctacgaaaggaacttcctgtgcggctggctaacaca
atgagagaagttaatcttctgccggataatttacttaaccgcccttcagtgggattggtt
cagagttggtatatgcagagttttcttgaacttttagaatatgaaaataagagccctgag
gatccacaggtcttggataactttctacaagttctgattaaagtcnagaatagacacaat
gatgtggttcctacaatggcgcaaggacttattaatcagcacacacttctgtttgggggt
gacactaatcctgttcatcctaaacacataggaagtatcgatcccacctgtaatgtggcg
gatgtggtgaaagatgcatatgaaacagccaagatgctgtgtgaacagtattacctggta
gctccagagctggaagttgaagaattcaatgccaaagcgccagacaaacctattcaggtg
gtttatgtgccctcacatctgtttcatatgctatttgagttgttcaagaactcaatgaga
gcgacagtcgaactctatgaagacagaaaagagggctaccccgctgttaaaaccctcgtt
actttgggtaaagaagacttatccattaagatcagtgacctaggcggtggtgttccactt
cgaaaaatagatcgtctttttaactacatgtattcgactgctcctagacccagcctggag
cctaccagagctgcccctttggctggatttggttatggtttgccaatttcccgtctgtat
gctagatattttcaaggagatctgaaactgtattccatggaaggagtgggtactgatgct
gtcatttatttgaaggctctttcaagtgagtcatttgagagacttccagtttttaataag
tccgcatggcgccattacaagaccacgcctgaagccgacgattggagcaatcccagcagt
gaacccagggatgcttcaaaatacaaagcgaaacaggacaagatcaagactaatagaact
ttctag

DBGET integrated database retrieval system