KEGG   Macaca mulatta (rhesus monkey): 699418Help
Entry
699418            CDS       T01028                                 

Definition
eosinophil lysophospholipase-like
Orthology
K13334  
eosinophil lysophospholipase (galectin-10) [EC:3.1.1.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     699418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 139 aa AA seqDB search
MSLLSVPHTESVSLSTGSTVTIKGRPLVCFFNEPHLQVDFHTEMKEDSDIAFHFQVYFGN
RVVMNSREFKIWKEEVESKNMPFQDGQEFELSILVLEDKYQVMVNGQAYYNFNHRIPVSS
VKMVQVWRDISLTKFNVSN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctatccgtgccacacacagagtctgtgtccttgtctactggatctactgtg
acaatcaaagggagaccgcttgtctgtttcttcaatgaaccacatctgcaggtggatttc
cacaccgagatgaaggaggactcagacattgccttccatttccaagtgtactttggcaat
cgtgtggtcatgaacagccgtgagtttaagatctggaaggaggaggtggaatccaagaat
atgccctttcaggatggccaagaatttgaactgagcatcttggtcctggaagataagtac
caggtaatggtcaatggccaagcctattacaactttaaccatcgaatcccggtcagttct
gtgaagatggtgcaagtgtggagagatatctctctgaccaaatttaatgtcagcaattga

DBGET integrated database retrieval system