KEGG   Macaca mulatta (rhesus monkey): 699486Help
Entry
699486            CDS       T01028                                 

Gene name
CES1
Definition
carboxylesterase 1
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    699486 (CES1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     699486 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 521 aa AA seqDB search
MWLRALVLATLAAFTAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCSQDAVAGQVLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQLAALHWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTAVLVKKGDVKPLAEQIAIAAGCQTTTSAVMVHCLRQKTEEELLETTLK
MKFFSLDLHGDPRESHPFLGTLIDGLLLPKTPEELQAERKFNTVPYMVGFNKQEFGWIIP
MNPEVSVLGGPVEKITVQMGKLRGPRSGKELRNAGAPTYMYEFQYRPSFSSDMKPKTVIG
DHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPRWPEYNQEEGY
LQIGANTQAAQKLKDKEVAFWTTLFAKKAVEKPPQTEHIEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgtgctcttgtcctggccactcttgctgctttcacggcttgggggcacccg
tcctcgccacctgtggtggacaccgtgcatggcaaagtgctggggaagttcgtcagctta
gaaggatttgcacagcctgtggccgttttcctgggaatcccttttgccaagccccctctt
ggacccctgaggtttactccaccgcagcctgcagagccatggagcttcgtgaagaatgcc
acctcttaccctcctatgtgctcccaagatgccgtggcagggcaggtactctcagagcta
tttacaaaccgaaaagagaacattcctctcaagctttctgaagactgtctttacctcaat
atttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatccac
ggaggggggctgatggtgggtgcagcatcaacctatgatgggctggcccttgctgcccat
gaaaacgtggtggtggtgaccattcaatatcgcctgggcatctggggattcttcagcaca
ggggatgaacacagccgggggaactggggtcacctggaccagctggctgccctgcactgg
gtccaggacaacattgccagctttggagggaacccaggctctgtgaccatctttggagag
tcagcgggaggagaaagtgtctctgttcttgttttgtctccattggcaaagaacctcttc
caccgggccatttctgagagtggcgtggctctcactgctgttctggtgaagaaaggtgat
gtcaagcccttggctgagcaaattgctattgctgctgggtgtcaaaccaccacctcagct
gtcatggttcactgcctgcgacagaagacggaagaggagctgttggagacaacattgaaa
atgaaattcttctctctggatttacatggagaccccagagagagtcaccctttcttgggc
accttgattgatgggctgctgctgccgaaaacacctgaagaacttcaagctgaaaggaag
ttcaacactgtcccctacatggtcggatttaacaagcaggagtttggctggattattcca
atgaatcctgaagtgtctgttctgggagggccagtagagaaaataactgtgcagatggga
aaactgagggggcctaggagtgggaaggagctgaggaatgctggagcgcccacctacatg
tatgagtttcagtatcgtccaagcttctcatcagacatgaaacccaagacggtgatagga
gaccacggggatgagctcttctctgtctttggggctccatttttaaaagagggtgcctct
gaagaggagatcagactcagcaagatggtgatgaaattctgggccaactttgctcgcaat
ggaaaccccaatggggaagggctgccccgctggccagagtacaaccaggaggaagggtac
ctgcagattggtgccaacacccaggcggcccagaagctgaaggacaaggaagtggctttc
tggaccacactctttgccaagaaggcagtggagaagccaccccagacagaacacattgag
ctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system