KEGG   Macaca mulatta (rhesus monkey): 699524Help
Entry
699524            CDS       T01028                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    699524 (FLNA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    699524 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    699524 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    699524 (FLNA)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   699524 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 2647 aa AA seqDB search
MSSSHSRAGQSAAGAAPGGGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSTFEVYVDKSQGDASKVTAQGPGLSRSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPAGQKGTVEPQLEARGDSTYRCTYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPTVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSDDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYIICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDMTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADAAKVVAKGLGLSKAYIGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
NT seq 7944 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcccactctcgggcgggccagagcgcagcaggcgcggctccgggtggtggc
gctgacacgcgggacgcggagatgccggccaccgagaaggacctcgcggaggacgcgccg
tggaagaagatccagcagaacactttcacgcgctggtgcaacgagcacctgaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgacgggctgcggctcatcgcgctg
ctggaggtgctcagccagaagaagatgcaccgcaagcacaaccagcggcccactttccgc
caaatgcagcttgagaatgtgtcggtggcgctcgagttcctggaccgcgagagcatcaaa
ctggtgtccatcgacagcaaggccatcgtggacgggaacctgaagctgatcctgggcctc
atctggaccctgatcctgcactactccatctccatgcccatgtgggatgaggaggaggat
gaggaggccaagaagcagacccccaagcagaggctcctgggctggatccagaacaagctg
ccacagctgcccatcaccaacttcagccgagactggcagagcggccgggccctgggtgcc
ctggtcgacagctgtgccccgggcctgtgtcctgactgggactcttgggatgccagcaag
cctgtgaataatgcacgagaggccatgcagcaggcggatgactggctgggcatcccccag
gtgatcacccccgaggagattgtggaccccaacgtggatgagcattctgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggcacccttgcggcccaaactgaac
ccgaagaaagcccgtgcctacgggccaggcattgagcccacaggcaacatggtgaagaag
cgggcggagttcactgtggagaccagaagtgccggccagggagaggtgctggtgtacgtg
gaggacccggccggacaccaggaggaggcaaaagtgactgccaataatgacaagaaccgc
accttttctgtctggtacgtccccgaggtgacggggactcataaggtcactgtgctattt
gctggccagcacatcgccaagagcacattcgaggtgtatgtggataagtcacagggtgac
gccagcaaagtgacagcacaaggccccggcctgagccgcagtggcaacatcgccaacaag
accacgtactttgagatctttacagcaggagctggcacgggcgaggttgaggttgtgatc
caggaccccgcgggacagaagggcacggtagagcctcagctggaggcccggggcgacagc
acataccgctgcacctaccagcccaccatggagggtgtccacaccgtgcacgtcacgttt
gccggcgtgcccatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
agtgcctgccgggcagtcggccggggcctccagcccaagggtgtgcgggtgaaggagaca
gccgacttcaaggtgtacacaaagggcgctggcagtggggagctgaaggtcaccgtgaag
ggccccaagggagaggagcgcgtgaagcagaaggacctaggggatggcgtgtatggcttc
gagtattaccccacggtccctgggacctatatcgtgaccatcacatggggcggtcagaac
attgggcgcagtcccttcgaggtgaaggtgggcaccgagtgtggcaatcagaaggtgcgg
gcatggggccctgggctggagggcggcgtcgttggcaagtcagcagactttgtggtggag
gctattggggacgacgtgggcaccctgggcttctcggtggaaggtccatcgcaggccaag
atcgaatgtgacgacaagggtgatggctcctgtgatgtgcgctactggccgcaggaggct
ggcgagtatgctgttcacgtgctgtgcaacagtgacgacatccgcctcagccccttcatg
gctgacatccgtgatgcaccccaggacttccacccagacagggtgaaggcacgtgggcct
ggattggagaagacaggtgtggccgtcaacaagccagcagagttcacagtggatgccaag
cacggtggcaaggccccactccgggtccaagtccaggacaatgaaggctgccctgtggag
gcattggtcaaggacaatggcaacggcacttacagctgttcctacgtgcccaggaagcca
gtgaagcacacagccatggtgtcctggggaggcgtcagcatccccaacagccccttcagg
gtgaatgtgggagctggcagccaccccaacaaggtcaaagtatatggccccggagtggcc
aagacagggctcaaggcccacgagcccacctacttcactgtggactgcgccgaggctggc
cagggggatgtcagcatcggtatcaagtgtgcccctggagtggtaggtcccgctgaagct
gacatcgacttcgacatcatccgcaacgacaatgacaccttcacggtcaagtacacaccc
cggggggctggcagctacaccattatggtcctctttgctgaccaggccacgcccaccagc
cccatccgagtcaaggtggagccctctcatgacgccagtaaggtgaaggctgagggccct
ggcctcagtcgcactggtgtcgagcttggcaagcccacccacttcacagtcaatgcgaaa
gccgctggcaaaggcaagctggacgtccagttctcaggactcaccaagggggatgcagtg
cgagacgtggacatcatcgaccaccatgacaacacctacacagtcaagtacacacctgtg
cagcagggtccagtaggcgtcaatgtcacttatggaggggatcccatccctaagagccct
ttctcggtggcagtatctccaagcctggacctcagcaagatcaaggtgtctggcctggga
gagaaggtggacgttggcaaagaccaggagttcacagtcaaatcaaagggtgctggtggt
caaggcaaagtggcatccaagattgtgggcccctcaggtgcagcagtgccctgcaaggtg
gagccaggcctaggagctgacaacagtgtggtgcgcttcgtgcctcgtgaggaagggccc
tatgaggtggaggtgacctatgacggcgtgcctgtgcctggcagcccctttcctgtggaa
gctgtggcccctaccaagcctagcaaggtgaaggcgtttgggccggggctgcagggaggc
agtgcaggctcccccgcccgcttcaccattgacaccaagggcgccggcacaggtggcctg
ggcttgacagtggagggcccctgcgaggcacagctcgagtgcttggacaacggggacggc
acatgttccgtgtcctatgtgcccaccgagcccggggactacaacatcaacatccttttc
gctgacacccacatccctggctccccattcaaggcccatgtggttccctgctttgacgca
tccaaagtcaagtgctcaggccctgggctggagcgggccaccgctggggaagtgggccaa
ttccaagtagactgctcgagtgcaggcagtgcagagctgaccattgagatctgctcagag
gcggggctgccagccgaggtgtacatccaggaccacggcgacggcacgcacactatcaca
tacattcctctctgccccggggcctacactgtcaccatcaagtacggcggccagcctgtg
cccaacttccccagcaagctgcaggtggagcccgcagtggacacttccggcgtccagtgt
tacgggcctgggattgagggccagggtgtcttccgtgaggccaccactgagttcagtgtg
gacgcccgggctctgacacagaccggagggccgcacgtcaaggcccgtgtggccaacccc
tcaggcaacctgacagagacctacgttcaggaccgaggcgacggcacgtacaaagtggag
tacacgccttacgaggagggactgcactcggtggacgtgacctacgacggcagccccgtg
cccagcagccccttccaggtgcccgtgactgagggctgcgacccctcccgggtgcgtgtc
catgggccaggcatccaaagtggcaccaccaacaagcccaacaagttcactgtggagacc
aggggagctggcacgggcggcctgggcctggctgtagagggcccctccgaggccaagatg
tcctgcatggataacaaggatggcagctgctcagttgagtacattccttatgaggctggc
acctacagcctcaatgtcacctatggtggccatcaagtgccaggcagtcctttcaaggtc
cctgtgcatgatgtgacagatgcgtccaaggtcaagtgctctgggcccggcctgagccca
ggcatggttcgtgccaaccttcctcagtccttccaggtggacacaagcaaggctggtgtg
gccccactgcaggtcaaagtgcaagggcccaaaggcctggtggagccagtggacgtggtg
gacaacgctgatggcacccagaccgtcaattatgtgcccagccgagaagggccctacagc
atctcagtgctgtatggagatgaagaggtgccccggagccccttcaaggtcaaggtgctg
cctactcatgatgccagcaaggtgaaggccagtggccccggactcaacaccactggcgtg
cccgccagcctgcccgtggagttcaccatcgatgcaaaggatgctggggagggcctgctg
gctgtccagatcacggatccggaaggcaagccgaagaagacacacatccaagacaaccat
gacggcacgtatacagtggcctatgtgccagatgtgacgggtcgctacaccatcctcatc
aagtatggtggtgacgagatccccttctccccgtaccgcgtgcgtgccgtgcccaccggg
gacgccagcaagtgcacagtcacagtgtcaatcggaggtcacgggctaggtgctggcatc
ggccccaccatccagattggggaggagacggtgatcaccgtggacactaaggcagcaggc
aaaggcaaagtgacatgcaccgtgtgcacgcctgatggctcagaggtagatgtggacgtg
gtggagaatgaggacggcacttttgacatcttctacacggccccccagccgggcaaatac
attatctgtgtgcgctttggtggcgagcacgtgcccaacagccccttccaagtgacggct
ctggctggggaccagccctcggtgcagcccccgctacggtctcagcagctggccccacag
tatacctacgcccagggcggtcagcagacttgggccccagagaggcccctggtgggtgtc
aatgggctggatatgaccagcctgaggccctttgaccttgtcatccccttcaccatcaag
aagggtgagatcacaggggaggttcggatgccctcaggcaaggtggcacagcctgccatc
actgacaacaaagatggcaccgtgaccgtacggtatgcacccagtgaggctggcctgcac
gagatggacatccgctatgacaacatgcacatcccaggaagccccttgcagttctatgtg
gattatgtcaactgcggccatgtcactgcctatggacctggcctcacccacggagtagtg
aacaagcctgccactttcaccgtcaacaccaaagatgcaggagaggggggcctgtctctg
gccatcgagggcccgtccaaagcagaaatcagctgcactgacaaccaggatgggacatgc
agcgtctcctacctgcctgtgttgccgggtgactacagcatcctagtcaagtacaatgaa
cagcacatcccaggcagccccttcacggcccgggtcacaggtgacgactccatgcgtatg
tcccacctaaaggtgggctctgctgccgacatccccatcaacatctcagagacggatctc
agcctgctgacagccactgtggtcccgccctcaggccgggaggagccctgtttgctgaag
cggctgcgtaatggccacgtggggatttcattcgtgcccaaggagacaggggagcacctg
gtgcacgtgaagaaaaacggccagcacgtggccagcagccccatcccggtggtgatcagc
cagtcggaaatcggggatgccagtcgcgttcgggtctctggccagggccttcacgaaggc
cacacctttgagcctgcggagtttatcattgatacccgagatgcaggctatggtgggctc
agcctgtccattgagggccccagcaaggtggacatcaacacagaggacctggaggacggg
acgtgcagggtcacctactgccccacagagcctggcaactacatcatcaacatcaagttt
gccgaccagcacgtgcctggcagccccttctctgtgaaagtgacaggcgagggccgggtg
aaagagagcatcacccgcaggcgtcgggctccttcagtggccaacgttggcagtcattgt
gatctcagcctaaagatccctgaaattagcatccaggatatgacagcccaggtgaccagc
ccatcgggcaagagccatgaggccgagatcgtggaaggggagaaccacacctactgtatc
cgctttgttcctgctgagatgggcacacacacagtcagcgtcaagtacaagggccagcac
gtgcctgggagccccttccagttcaccgtggggcccctaggggaagggggagcccacaag
gtccgagctgggggccctggcctggagagggctgaagctggagtgccagccgaattcagt
atctggacccgggaagctggtgccggaggcctggccattgctgtcgagggccccagcaag
gctgagatctctttcgaggaccgcaaggacggctcctgtggtgtggcttatgtggtccag
gagccaggtgactacgaagtctcagtcaagttcaacgaggaacacattcccgacagcccc
ttcgtggtgcctgtggcttctccgtctggcgatgcccgccgcctcactgtttctagcctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaatggggcc
aagggggcaatcgatgccaaggtgcacagcccctcaggagccctggaggagtgctatgtc
acagaaattgaccaagataaatatgctgtgcgcttcatccctcgggagaatggcgtttac
ctgattgacgtcaagttcaatggcacccacatccctggaagccccttcaagatccgagtt
ggggagcccggtcatggaggggacccaggcttggtgtctgcttacggagcaggcctggaa
ggcggtgtcacagggagcccagctgagttcatcgtgaacacgagcaatgcaggagctggt
gccctgtcggtgaccattgatggcccctccaaggtgaagatggattgccaggagtgccct
gagggctaccgtgtcacctatacccccatggcacctggcagctacctcatctccatcaag
tatggtggcccctatcacattgggggcagccccttcaaggccaaagtcacaggcccccgt
ctcgtcagcaaccacagcctccacgagacatcatcagtatttgtagactctctgaccaag
gccacctgcgcccctcagcatggggctccgggtcctgggcctgctgacgccgccaaggtg
gtggccaagggcctgggactgagcaaggcctacataggccagaagagcagcttcacggta
gactgcagcaaagcaggcaacaacatgctgctggtgggggttcatggcccaaggaccccc
tgcgaggagatcctggtgaagcacgtgggcagccggctctacagcgtgtcctacctgctc
aaggacaagggggagtacacactggtggtcaagtggggcgacgagcacatcccaggcagc
ccctaccgcgttgtggtgccctga

DBGET integrated database retrieval system