KEGG   Macaca mulatta (rhesus monkey): 699540Help
Entry
699540            CDS       T01028                                 

Gene name
USP31, USP48
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1301 aa AA seqDB search
MASLGLHAAGPRPQPAGIPSSWGGNYLPTVNMAAEAASVRGGRRWEARHXXXXXXXXPPA
SPAPPACAAEPVPGVAGLRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPSPDP
EQPAGRGAQGQGEVTEQLAHLVRALWTLEYTPQHSRDFKTIVSKNALQYRGNSQHDAQEF
LLWLLDRVHEDLNHSVKQSGQPPLKPPSETDMMPEGPFPVCSTFVQELFQAQYRSSLTCP
HCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAVPLSGTVARLREAV
SMETKIPTDQIVLTEMYYDGFHRSFCDTDDLETVHESDCIFAFETPEIFRPEGILSQRGI
HLNNNLNHLKFGLDYHRLSSPTQTAAKQGKMDSSTSRAGSDKIVLLVCNRACTGQQGKRF
GLPFVLHLEKTIAWDLLQKEILEKMKYFLRPTACIQVCPFSLRVVSVVGITYLLPQEEQP
LCHPTVERALKSCGPGGTAHVKLVVEWDKETRDFLFANTEDEYIPDAESVRLQRERHHQP
QTCTLSQCFQLYTKEERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQEGD
RRMKLQNMVKFPLTGLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGRDPEDYIYDLYAVC
NHHGTMQGGHYTAYCKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPSWSA
NSSVAGSTSSSLCEHWVSRLPGSKPASVTSAASSRRTSLASLSESVEMTGERSEDDGGFS
TRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSA
STLEKIGEAADDKVSISCFGSLRNLSNSYQEPSDSHSRREHKAVGRAPLAVMEGVFKDES
DTRRLNSSVIDTQSKHSAQGDRLPPVSDPFDNNNQIAYVDQSDSVDNSPVKEVKPPSHPG
SLTKKPESTTKKSPSSKGTSEPEKSLRKGRPALASQESSLSSTSPSSPLPVKVSLKPSRS
RSKADSSSRGSGRHSSPAPAPAQPRKESSPKSQDSVSSPSPQKQKSASALTYTASSMSAK
KASGPATRSPFPPGKSRTSDRSLSREGSRQSLGSDRASATSASKPNSPRVSQARAGEGRG
AGKHVRSSSMASLRSPSASIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLS
KKAGGSSVKSVCKNTGDDKGEKGHQPPASQQPNANATGKEQLVSKDPASAKHSLLSARKS
KSSQLDSGVPSSPGSRQSAEKSSKKLSSSMQTSARPSQKPQ
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctcgggcttcacgcagcaggaccgcgcccgcagccggcaggcatcccgtcc
agctggggaggcaactaccttcccacagtgaatatggcggccgaggcggcttcagtgcgg
ggcgggcggcgctgggaggcgcgtcacnnnnnnnnnnnnnnnnnnnnnncgccgcccgcc
tctcccgcgccgccggcttgcgccgccgagccagtgcccggcgtggcgggactccgcaac
catggcaacacgtgcttcatgaacgccacgctgcagtgcctcagcaacaccgagctcttc
gccgagtacctggcgctgggccagtaccgggcggggcgacccgagccctcgcctgacccc
gagcagcctgcgggccgcggcgcgcagggccagggcgaggtcaccgagcagctggcgcac
ctggtgcgggccctctggaccctggagtacaccccgcagcatagccgcgactttaagact
attgtgtcaaagaatgcactgcagtaccggggaaattcccagcatgatgctcaggagttt
ctactgtggcttttggaccgagttcacgaagacctcaaccattcagtgaagcagagtggc
cagccgcctctgaagccaccgtcagagactgatatgatgcctgagggaccttttcctgtc
tgtagcacttttgtacaagaactctttcaagcccaataccgatcttctttgacgtgtcct
cattgtcagaaacagagcaacacttttgatcctttcctttgcatttctttgccaattcct
ctaccccacacaaggcctctctatgtcactgtagtgtatcaagggaaatgttctcactgc
atgaggattggtgtggccgtgcctctgtctgggactgttgccagacttcgggaagcagtg
tctatggaaacaaagatccccactgatcagattgtgttaacagaaatgtactatgatggg
ttccatcgttccttttgtgatacagacgacctggaaacagtccatgaaagcgactgcatt
tttgcctttgagactcccgaaatatttaggcctgaaggaattctcagtcaaagaggaatt
catttaaacaacaacctaaaccacttgaaatttggcttggattatcatagactgtcttct
cctacacaaacagcagcaaagcaagggaaaatggattcgtccacctcaagagcaggcagc
gacaagattgtcctgttggtgtgtaaccgagcctgcactgggcaacaagggaaaagattt
ggactgccttttgtgctgcacttagagaagacaatagcttgggaccttctgcagaaggaa
atcttggagaagatgaagtatttcttgaggcccacggcttgcattcaggtgtgtccattc
agcttgcgtgtggtcagtgttgttggaataacatacttgctgccccaggaggagcagccc
ttgtgccacccgacagtagaaagggcattaaaatcttgtggaccaggtggcaccgctcat
gtgaaattagtagtcgagtgggacaaggaaacaagagatttcttgtttgcaaatactgaa
gatgagtacatccctgatgcagaaagtgttcgtctgcaaagggagcgtcatcatcagcct
caaacctgtactttatcccagtgtttccaactctacaccaaagaggagcggcttgccccc
gatgatgcctggcgttgcccacactgtaagcagctgcagcagggaagcattacattaagc
ctctggactctgcctgatgtgcttattatacatctaaagagatttcggcaggaaggagac
aggcgcatgaaacttcagaacatggtcaagttccccttgactggcctggacatgacacct
catgtggttaagaggagccagagcagctggagtttgccatcccattggtccccgtggaga
cggccctatggactcgggagggaccctgaggactacatctatgacctgtatgctgtgtgc
aatcaccatggcaccatgcaaggggggcactacacagcatactgtaagaactctgtggac
ggcctctggtactgcttcgacgacagtgatgtgcagcagctatcagaagatgaggtctgc
acgcagacagcatacatcctcttctaccagaggcggacagccatcccgtcatggtcagcc
aacagctcagtggcaggctccacgagttcttccctgtgcgaacactgggtgagccggctc
ccgggcagcaagccagccagcgtgacctctgcagcttcctccagacgcacctccttggcc
tcgctctctgagtccgtggagatgactggagaaaggagtgaagatgatggaggcttttca
actcgaccatttgtgagaagtgtccagcgtcagagtttgtcatctagatcttctgtcacc
agccccttggccgtcaatgaaaattgcatgagaccttcatggtccctgtctgctaagctg
cagatgcgctccaattctccatcccgattttcaggggactcgccaattcacagctctgcc
tccaccttggagaagattggggaggcagcagatgacaaggtctccatctcttgctttggt
agcttgcggaacctttctaacagttaccaggaaccaagcgacagtcatagtcgccgtgag
cacaaggctgtgggccgggcccctctggctgtcatggaaggtgtgttcaaagacgaatcg
gacacccgcagattgaactccagtgtcatagatacacagagcaaacattcagcacaaggg
gaccgcctgcccccggtctctgatccatttgataataataatcagattgcctatgtggat
cagagcgactctgtagacaactctccagtcaaagaggtgaaaccccccagccacccaggc
tcactcacgaagaaaccagagagcacaaccaagaaatcccccagttccaaaggcacttct
gagccagagaaaagcttgcggaaggggagaccggccttggcaagccaggagtcatccctt
tcaagtacatccccttcttctcctcttcctgtaaaagtctctctaaaaccctcccgctcc
cgcagcaaagcagattcttcttccaggggcagtggacggcattcatcccctgcccctgcc
cctgcccaacccagaaaggagtcatccccgaaatctcaggactccgtgtcgtctccttcg
ccacagaagcagaagtcagcctcggccctcacctacactgcttcctccatgtctgccaaa
aaggcctcgggccctgccacaaggagccccttcccacctgggaagagcaggacttcagac
cggagcttgagtagagagggctccagacaaagcttgggttccgacagagccagcgccacc
tctgcctccaaacccaactcccctcgggtgagccaggcccgagcaggagagggcaggggg
gccgggaagcacgtgcggagctcctccatggccagcctgcgctcccccagtgcaagcatc
aagtctggtttgaagagggacagcaagtctgaggacaaggggctgtccttcttcaagtca
gccttgagacagaaggaaacacggcgctcgacagatcttggcaagacagccttgctctct
aaaaaggctggtgggagctctgttaagtccgtctgtaagaacaccggggacgacaagggg
gagaaaggccaccagcctccagcttcccagcagccaaatgcaaatgcaacgggaaaagag
cagcttgtctccaaggaccctgcttctgccaaacattccctgctgtccgctcgcaaatcc
aagtcttcccaactggactctggagttccctcgtctcctggtagcaggcagtctgcagag
aaatcctcaaaaaagttatcttctagcatgcaaacctctgcacggccttctcaaaaacct
cagtga

DBGET integrated database retrieval system