KEGG   Macaca mulatta (rhesus monkey): 699569Help
Entry
699569            CDS       T01028                                 

Gene name
PLCD4
Definition
phospholipase C, delta 4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    699569 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    699569 (PLCD4)
   04070 Phosphatidylinositol signaling system
    699569 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    699569 (PLCD4)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     699569 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 799 aa AA seqDB search
MASLLQDRLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLTEELPLEQGFTVVFHGRRSNLDLVANSVEEAQIWMRGLH
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVEFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLREEQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEVEPGLEGEHESELALESQFETESEPEPQEQN
LQIKDKKKVVTCPLFCPSICCQIVAQAPISKPGSLLLSQQKSKTILCPALSSLVIYLKSV
SFRSFTHSKKHYHFYEISSFSETKAKRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYN
PQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCGYVLKPDFLRDNQSSFHPERPISP
FKAQTLLIQVISGQQLPKLNKTKEGSIVDPLVKVQIFGVRLDTARQETNYVENNGFNPYW
GQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTLPWSCMQQGYRHIHLLSKDGISLC
PASIFVYICIREGLEGDES
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcatccctgctgcaagaccggctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcgcaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggagacaatacgtaatggccatgattccgagttgctgcgtagc
ctgacagaggagctccccctggagcagggcttcaccgttgtcttccatggccgccgctcc
aacctggacctggtggccaacagtgttgaggaggcccagatatggatgcgagggctccac
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagt
gactggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggaaatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctgggactctggaaggagaagaatttgtagagttctataag
gcattgactaaacgtgctgaggtgcaagaactatttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccgagaggagcagaaggagagagactgc
acctccgagcttgctctggaactcattgaccgctatgaaccttcagacagtggcaaactg
cggcatgtgctgagcatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcctctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagtggggaacctgtcgtttaccatggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacgtcagactacccagtcatc
ttgtccctggaaacccactgcagctgggagcagcaacagaccatggcccgccatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcacctgaggagcttcggaggaagatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagtagagcctgggctggagggtgagcatgagtca
gaattggcgctggagtcccagtttgagactgagtctgagcctgagccccaggagcagaac
cttcagattaaggacaaaaagaaggttgtgacgtgtccgctgttttgtccgtctatctgt
tgtcagattgtggcccaggctcctatttccaagcctgggtcccttctcttgtcccagcag
aaatccaagaccatcttgtgtccagccctctcttccctggttatctacttgaagtctgtc
tcattccgcagcttcacacattcaaagaagcactaccacttctatgagatatcatctttc
tctgaaaccaaggccaagcgcctcatcaaggaggctggcaatgagtttgtgcagcacaat
acttggcagttaagccgtgtgtatcccagcggcctgaggacagactcttccaactacaac
ccccaggaactctggaatgcaggctgccagatggtggccatgaatatgcagactgcaggg
cttgaaatggacatctgtgatgggcatttccgccagaatggtggctgtggctatgtgctg
aagccagacttcctgcgtgataaccaaagttccttccaccccgagagacccatcagccct
ttcaaggcccagactctcttaatccaggtgatcagtggtcagcaactccccaaactcaac
aagaccaaagagggttccattgtggatccactggtgaaagtgcagatctttggtgtccgt
ctagacacagcacggcaggagaccaactatgtggagaacaatggttttaatccatactgg
gggcagacactgtgtttccgggtgctggtgcctgaacttgccatgctgcgttttgtggta
atggattatgactggaaatcccgaaatgactttattggtcagtacaccctgccttggagc
tgcatgcaacaaggttaccgccacattcacctgctgtccaaagatggcatcagcctctgc
ccagcttccatctttgtgtatatctgcattcgggaaggtctggagggggatgagtcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system