KEGG   Macaca mulatta (rhesus monkey): 699601Help
Entry
699601            CDS       T01028                                 

Gene name
CES5A, CES7
Definition
carboxylesterase 5A (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     699601 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 551 aa AA seqDB search
MSGNWVHPGQILFWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGV
PFAAPPLGPLRFTNPQPASPWDNLREATSYPNLCLQNSEWLRLDQHMLKVLVWFPGGAFK
TGSASIFDGSALAAYEDVLVVVIQYRLGIFGFFTTWDQHAPGNWAFKDQVAALSWVQKNI
EFFGGDPSSVTIFGESAGAISVSSLILSPMAEGLFHKAIMESGVAIIPYLKAYDYEKSED
LQVVAHFCGKNASDSEDLLRCLRTKSSKELLTLSQKAKSFTRVVDGAFFPNEPLDLLSQK
AFKEIPSIIGVNNHECGFLLPMKEAPEILSGSNKSLALHLIQNILHIPPQYLHLVANEYF
HDKHSLTEIRDGLLDLLGDVFFVVPALITARYHRDAGAPVYFYEFRHRPQCFEDTKPAFV
KADHADEVRFVFGGAFLKGDIVMFEGATEEEKLLSRKMMKYWATFARTGNPNGDDLPLWP
AYNLTEQYLQLDLNMSLGQRLKEPRVEFWTSTIPLILSASDTLHSPLSFLIFLSLLQPFF
FSCVPWEVIFL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaattgggtgcacccaggccagatcctattttgggctatctgggtccttgca
gcccccaccaaggggccttctgctgaagggccacagaggaacaccaggctgggatggatt
cagggcaagcaagtcactgtgctgggaagccctgtgcctgtgaacgtgttcctcggagtc
ccctttgctgctcccccgctgggacccctgcgatttacgaaccctcagcctgcatcgccc
tgggataacttgcgagaagccacctcctaccctaatttgtgcctccagaactcagagtgg
ctgcgcttagatcaacacatgctcaaggtcttggtgtggttcccagggggtgccttcaag
actggctcagcctccatcttcgatgggtccgctctggctgcctatgaggacgtgctggtt
gtggtcatccagtaccggctgggaatatttggcttcttcaccacatgggatcagcacgcg
ccggggaactgggccttcaaggaccaggtggctgctctgtcctgggtccagaagaacatc
gagttctttggtggggaccccagctctgtgaccatctttggcgagtccgcgggagccata
agtgtttcaagccttatactgtctcccatggccgaaggcttattccacaaagccatcatg
gagagtggggtggccatcatcccttacctgaaagcctatgattatgagaagagtgaggac
ctgcaggtggttgcacatttctgtgggaagaatgcatcagactctgaggacctgctgagg
tgcctgaggacaaaatcctccaaggagctgctgaccctcagccagaaagcaaagtctttc
actcgagtggttgatggtgctttctttcctaatgagcctctagatctattgtctcagaaa
gcatttaaagaaattccttccatcatcggagtcaataaccatgagtgtggcttcctgctg
cctatgaaggaggctcctgagatcctcagtggctccaacaagtcccttgccctccatctg
atacaaaacatcctgcacatcccgcctcagtatttgcaccttgtggctaatgaatacttc
catgacaagcactccctgactgaaatccgagacggtcttctggacttgcttggagatgtg
ttctttgtggtccctgcactgatcacagctcgatatcaccgagatgctggtgcacctgtc
tacttctatgagtttcggcaccggccccagtgctttgaagacacgaagccagcttttgtc
aaagccgaccacgctgatgaagtccgctttgtgttcggtggtgccttcctgaagggtgac
attgttatgttcgaaggagccacggaggaggagaagttgctgagccggaagatgatgaaa
tactgggctacctttgctcgaactgggaatcccaatggggacgacctgcctctgtggcca
gcctataatctgaccgagcagtacctgcagctggacttgaacatgagcctcggacagaga
ctcaaagaaccgcgggtggagttttggaccagcaccatccccctgatcctgtctgcctcc
gacacgctccatagtcctctttctttcttaattttcctctctctcctccagcctttcttt
ttctcttgtgttccttgggaagttatctttctgtga

DBGET integrated database retrieval system