KEGG   Macaca mulatta (rhesus monkey): 699642Help
Entry
699642            CDS       T01028                                 

Definition
histone deacetylase 8-like
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mcc05203]
Human Diseases; Substance dependence; Alcoholism [PATH:mcc05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 415 aa AA seqDB search
MLTREHRCGRSEEQELEPWPSPKKARSGRCLRNGFKWKMEEPEEPADSGQSLIPVYIYSP
EYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKV
SQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGMCKVAINWSGGWH
HAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHK
FSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQIFESVLKEVYQAFNPKAVVL
QLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVI
LGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagggagcaccgctgcggccgatcagaggagcaggaactggagccctggccg
agtccgaaaaaagccagatctggaaggtgcctgcggaacggttttaagtggaagatggag
gagccggaggaaccggcggacagtgggcagtcgctgatcccggtttatatctatagtccc
gagtatgtcagtatgtgtgactccctggccaagatccccaaacgggccagtatggtacat
tctttgattgaagcatatgcactgcataagcaaatgaggatagttaagcccaaagtggcc
tccatggaggagatggccaccttccacactgatgcttatctgcagcatctccagaaggtc
agccaagagggcgatgatgatcatccggactccatagaatatgggctaggttatgactgc
ccagccactgaagggatatttgactatgcagcagctgtaggaggggctacaatcacagct
gcccaatgcctgattgacggaatgtgcaaagtagcaattaactggtctggaggctggcat
catgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtcctgggaata
ttacgattgcgacggaaatttgagcgtattctctacgtggatttggatctgcaccatgga
gatggtgtagaagacgccttcagtttcacctccaaagtcatgaccgtgtccctgcacaaa
ttctccccgggatttttcccaggaacaggtgacgtgtctgatgttggcctagggaaggga
cggtactacagtgtaaatgtgcccattcaggatggcatacaagatgaaaaatattaccaa
atctttgaaagtgtactaaaggaagtataccaagcctttaatcccaaagcagtggtctta
cagttgggagctgacacaatagctggggatcccatgtgctcctttaacatgactccagtg
ggaattggcaagtgtcttaagtacatccttcaatggcagttggcaacactcattttggga
ggaggaggctataaccttgccaacacggctcgatgctggacatacttgaccggggtcatc
ctagggaaaacactatcctctgagatcccagatcatgagtttttcacagcatatggtcct
gattatgtgctggaaatcacgccaagctgccggccagaccgcaatgagccccaccgaatc
cagcaaatcctcaactacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system