KEGG   Macaca mulatta (rhesus monkey): 699728Help
Entry
699728            CDS       T01028                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    699728 (GCK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    699728 (GCK)
   00052 Galactose metabolism
    699728 (GCK)
   00500 Starch and sucrose metabolism
    699728 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    699728 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    699728 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    699728 (GCK)
   04910 Insulin signaling pathway
    699728 (GCK)
   04917 Prolactin signaling pathway
    699728 (GCK)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    699728 (GCK)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    699728 (GCK)
   04950 Maturity onset diabetes of the young
    699728 (GCK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     699728 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 466 aa AA seqDB search
MAMDATRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
SATDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatgccacaaggagccaggcccagacagccttgactctggtagagcagatc
ctggcggagttccagctgcaggaggaggacctgaagaaggtgatgagacggatgcagaag
gagatggaccgtggcctgaggttggagacccatgaagaggccagtgtgaagatgctgccc
acctacgtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctg
ggtggcaccaacttcagggtgatgctggtgaaggtgggagaaggtgaggaggggcagtgg
agcgtgaagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgct
gagatgctcttcgactacatctccgagtgcatctccgacttcctggacaagcatcagatg
aagcacaagaagctgcccctgggcttcaccttctcctttcctgtgaggcatgaagacatc
gataagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaac
aatgtcgtggggcttctgcgagatgccatcaaacggagaggggacttcgaaatggatgtg
gtggcaatggtgaatgacacggtggccacgatgatctcctgctactacgaagaccatcag
tgcgaggtcggcatgattgtgggcacgggctgcaacgcctgctacatggaggagatgcag
aatgtggagctggtggagggggacgagggccgcatgtgcgtcaacaccgaatggggcgcc
ttcggggactcgggcgagctggacgagttcctgctggagtatgaccgcctggtggacgag
agctctgcaaaccccggtcagcagctgtatgagaagctcataggtggcaagtacatgggc
gagctggtgcggctcgtgctgctcaggctcgtggacgaaaacctgctcttccacggggag
gcctccgagcagctgcgcacacgcggagccttcgagacacgcttcgtgtcgcaggtggag
agcgacacgggcgaccgcaagcagatctacaacatcctgagcacgctggggctacgaccc
tcggccactgactgcgacatcgtgcgccgcgcatgcgagagcgtgtctacgcgcgctgca
cacatgtgctcggcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgag
gacgtaatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcaccccagcttc
aaggagcggttccacgctagcgtgcgcaggctgacgcccagctgcgagatcaccttcatc
gagtcggaggagggcagtggccggggcgcggccctggtctcggcggtggcctgtaagaag
gcctgcatgctgggccagtga

DBGET integrated database retrieval system