KEGG   Macaca mulatta (rhesus monkey): 699736Help
Entry
699736            CDS       T01028                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Necroptosis
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Adipocytokine signaling pathway
Relaxin signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Pertussis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Fluid shear stress and atherosclerosis
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    699736 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    699736 (MAPK10)
   04010 MAPK signaling pathway
    699736 (MAPK10)
   04012 ErbB signaling pathway
    699736 (MAPK10)
   04310 Wnt signaling pathway
    699736 (MAPK10)
   04668 TNF signaling pathway
    699736 (MAPK10)
   04068 FoxO signaling pathway
    699736 (MAPK10)
   04071 Sphingolipid signaling pathway
    699736 (MAPK10)
   04024 cAMP signaling pathway
    699736 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    699736 (MAPK10)
   04137 Mitophagy - animal
    699736 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    699736 (MAPK10)
   04215 Apoptosis - multiple species
    699736 (MAPK10)
   04217 Necroptosis
    699736 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    699736 (MAPK10)
   04530 Tight junction
    699736 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    699736 (MAPK10)
   04621 NOD-like receptor signaling pathway
    699736 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    699736 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    699736 (MAPK10)
   04659 Th17 cell differentiation
    699736 (MAPK10)
   04657 IL-17 signaling pathway
    699736 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    699736 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    699736 (MAPK10)
   04920 Adipocytokine signaling pathway
    699736 (MAPK10)
   04912 GnRH signaling pathway
    699736 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    699736 (MAPK10)
   04917 Prolactin signaling pathway
    699736 (MAPK10)
   04926 Relaxin signaling pathway
    699736 (MAPK10)
  Nervous system
   04728 Dopaminergic synapse
    699736 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    699736 (MAPK10)
   04722 Neurotrophin signaling pathway
    699736 (MAPK10)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    699736 (MAPK10)
  Development
   04380 Osteoclast differentiation
    699736 (MAPK10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    699736 (MAPK10)
   05231 Choline metabolism in cancer
    699736 (MAPK10)
   05210 Colorectal cancer
    699736 (MAPK10)
   05212 Pancreatic cancer
    699736 (MAPK10)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    699736 (MAPK10)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    699736 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    699736 (MAPK10)
   04931 Insulin resistance
    699736 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    699736 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    699736 (MAPK10)
   05133 Pertussis
    699736 (MAPK10)
   05152 Tuberculosis
    699736 (MAPK10)
   05164 Influenza A
    699736 (MAPK10)
   05161 Hepatitis B
    699736 (MAPK10)
   05160 Hepatitis C
    699736 (MAPK10)
   05168 Herpes simplex infection
    699736 (MAPK10)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    699736 (MAPK10)
   05169 Epstein-Barr virus infection
    699736 (MAPK10)
   05145 Toxoplasmosis
    699736 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    699736 (MAPK10)
  Drug resistance
   01522 Endocrine resistance
    699736 (MAPK10)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     699736 (MAPK10)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   699736 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
5
AA seq 464 aa AA seqDB search
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtttgtgcc
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacccatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctgtaccaaatgctgtgtggcattaagcacctc
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagccccggaggtcatcctggggatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaagctcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaac
gtctggtatgacccagctgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagtaatgaac
tcagaagagaagactaaaaatggcgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcttcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system