KEGG   Macaca mulatta (rhesus monkey): 699746Help
Entry
699746            CDS       T01028                                 

Gene name
SLC34A1, SLC34A2
Definition
solute carrier family 34 (sodium phosphate), member 1
Orthology
K14683  
solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   699746 (SLC34A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 639 aa AA seqDB search
MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEH
TCPCGEILERHEPLPAKLALEEEQKPEPRLVSKLRQAGAMLLKVPLMLSFLYLFICSLDV
LSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLE
VSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHITQLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDKSVITSIATGDESLRNHS
LIRIWCHPDSLEAPTSMSRAEANSSQTLGNATMEKCNHIFVDTSLPDLAVGLILLAGSLV
LLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGAGMTFVVQSSS
VFTSAITPLVGLDVISIERAYPLTLGSNIGTTTTAILAALASPKEKLFSAFQIALCHFFF
NISGILLWYPVPCTRLPIRMAKALGERTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQV
MVGVGTPFGALLAFVVLINVLQSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCC
ARPEPRSPPLPPRVFLEELPPSTPSPRLALPAHHNATRL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctatggagagaggctggggtcccctgctgtctccccactcccagtccgtggg
gggcatgtgatgcgagggacggcctttgcctacgtgcccagccctcaggtcctacacagg
atcccggggacctctgcctatgccttccccagcctgggccctgtggcccttgccgagcac
acctgcccctgtggggagatcctggagcgccatgaaccactgcctgccaagctggccctg
gaggaggagcaaaagccagagcccaggctggtctccaagctgcgccaggctggcgccatg
ctgctcaaggtgccgctgatgctcagcttcctctacctcttcatctgctccctggacgtg
ctcagctcagccttccagctggctggagggaaggtggccggtgacatcttcaaggataat
gccatcctgtccaacccggtggccgggctggtggtggggatcctggtgaccgtgctggtg
cagagctccagcacctccacgtccatcattgtcagcatggtctcctctggcttgctggag
gtaagctctgccatccccatcatcatgggttccaacatcggcacctctgtcaccaacacc
atcgtggccctgatgcaggcgggggacaggactgacttccggcgggccttcgcgggggcc
acggtgcatgactgctttaactggctgtcagtgctggtcctgctgcccctggaggctgcc
accggctacctgcaccacatcactcaactcgtggtggcctccttcaacatccatggtggc
cgtgacgctcctgacctactcaagatcatcacagagcccttcacgaagctcatcatccag
ctggacaagtccgtgataaccagcattgccaccggtgatgagtccctgaggaaccacagt
ctcatccggatctggtgccacccagactccttagaggctcccacctccatgtcgagagca
gaggccaactccagccagacccttggaaatgccaccatggagaaatgcaaccacatcttt
gtggacaccagcctaccggacctggctgtggggctcatcctgctggcaggatccctggtg
ctgctgtgcacctgcctcatcctcctcgtcaagatgctcaactccctactcaagggccaa
gtggccaaggtcatccagaaggtcatcaataccgacttccctgcccccttcacctgggta
acaggctactttgccatggtggtgggcgccggcatgaccttcgtggtccagagcagttcc
gtgttcacctcggccatcaccccactcgttggcctcgatgtgatcagcattgagagggcc
tacccactcacactgggttccaacatcggcaccaccaccacggccatcctggctgccctg
gccagccccaaggagaagctgttcagcgctttccagattgccctctgtcacttcttcttc
aacatctcgggcatccttctgtggtacccggtgccctgcacacgcctgcccatccgcatg
gccaaggcgctgggggaacgcacagctaagtaccgctggttcgctgtcctctatctcctt
gtctgcttcctgctgctgccctcactggtgtttggcatctccatggcaggctggcaggtc
atggtaggtgtgggcacgcccttcggggccctgctggccttcgtggtgctcatcaatgtc
ctgcagagtcggagtcccgggcacttgcccaagtggttacagacatgggacttcctgcct
cgatggatgcactccctgaagcctctggaccatctcatcacccgtgccaccctatgctgt
gccaggcctgagccccgctcacccccgctaccccctagggtcttcctggaggagttaccc
ccttccacgccctccccccgccttgcactgcctgctcaccacaatgccacccgcctctag

DBGET integrated database retrieval system