KEGG   Macaca mulatta (rhesus monkey): 699934Help
Entry
699934            CDS       T01028                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     699934 (ART4)
Cellular antigens [BR:mcc04090]
 Proteins
  699934 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 330 aa AA seqDB search
MKMQGQRRSTCDTSKWGPLMNRCKKILLPTTAAPTVIRIWLLGGLLPFLLLLSGLQRPTD
GSEVAMKIDFDFAPGSFDDQYQGCSKEVMEKLTQGDYFTKDIEAQKNYFGMWQKAHLTWL
NQGKVLPQNMTTTHAVAILFYTLNSNVRSNFTRAVAYVARAPQQYERSFQFKYLHYYLTT
AVQLLRKDSVMKNGTPLCYEVHYRTKDVHFSAYTGATIRFGQFLSTSLLKEEAQEFGNQT
LFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSSHPRGNWLQLRSTGNLSTYNCQLLK
ASSKKCIPDPIAIASLSFLASVIIFSKSRV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcaagggcaaaggagaagcacttgtgatacaagcaaatggggtccattgatg
aacagatgcaagaagattcttctcccaactactgcagctcctacagtgataagaatctgg
ctccttggaggcctgctgccattcctgctgctcctctctggcctgcagagacccacagac
ggttctgaggttgcgatgaaaatcgactttgacttcgcaccaggttcctttgatgatcag
taccaaggctgtagcaaagaggttatggagaaactaactcaaggggattatttcacaaaa
gacatagaagcccagaagaattactttgggatgtggcaaaaagctcacttaacctggctt
aaccaaggaaaagttctaccccagaacatgactaccacgcatgctgtggctattttgttt
tatacattgaacagcaatgttcgttctaactttactagagccgtggcctatgttgccagg
gctccacagcagtatgaacgttcattccaattcaaatatttacactactacctcaccaca
gcagtccagctgctgaggaaagacagcgtcatgaagaatggcactcctctgtgctatgag
gtgcattataggacgaaggatgtccacttcagcgcctacacaggtgccaccattcgattt
ggccaattcctctccacatccctcctaaaagaagaggcacaggagtttgggaaccagaca
ctatttaccatattcacatgcctgggtgcacctgtacaatacttctccctcaagaaggaa
gtcttgatccctccctatgagttgttcaaagttataaatatgagctcccacccaagagga
aactggttgcagttgaggtcaactggaaacctgagcacgtacaactgtcagctgctaaaa
gcttccagcaagaaatgcatccctgatcctatagctattgcatctctctcctttttggcc
agtgtcatcatcttttccaaaagccgagtataa

DBGET integrated database retrieval system