KEGG   Macaca mulatta (rhesus monkey): 699963Help
Entry
699963            CDS       T01028                                 

Gene name
SUV420H2
Definition
suppressor of variegation 4-20 homolog 2 (Drosophila)
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    699963 (SUV420H2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     699963 (SUV420H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 461 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTAHYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGDGFFGEKNEHCECYTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQGLDSGGRQGLLGPRVCLHPSPLRRDPFCAAC
QPLRLPACSARPDTSPLWLQWLPQPQPRVRSRKRRRPRPRRAPVLSTHHAARISLHRWGG
CGPHCRLRGEALVALGQPPRARWVPQQDWHWARRYGLPYVVRVDLRRLAPAPPPTPAPAG
TPGPILVPKQALAFAPFSPPKRLRLVVSHGSIDLDVDGEEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggggccggacagagtgacagcacgagaactgtgcgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggtttccgcacccataagatgaacgtcagccctgtgccc
ccactgcggcgacagcagcacctgcgctcagcgctggaaactttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggacggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacgtctatcgctacctccgtgccttc
ctgccggaaagtggctttaccatcctgccctgcacgcgctactccatggagaccaacggg
gccaagatcgtgtccactcgtgcttggaaaaagaatgagaagctggagctgctggtgggc
tgcatcgcagagctgcgggaggcggatgaggggctgctgagggctggtgagaatgacttc
agcatcatgtactcaacccgcaagcgaagtgctcagctgtggctgggcccagccgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatgggaacgccgcctgt
gtgaaggtgctccgggacatcgagcctggggacgaggtgacgtgcttctacggcgatggc
ttcttcggcgagaaaaatgagcactgtgaatgctacacctgtgagaggaaaggcgaagga
gctttccgaacgagacctagggagcctgcgttgccaccacggcccctggacaagtaccag
ctacgtgagaccaagcggcggctgcaaggcctggacagcggcggccgacagggcctcctg
ggccctcgggtctgcctgcacccgtccccactgcgccgggacccgttctgtgccgcctgc
caacccctgcgcctgccagcctgtagcgcccgcccagacacctcacccctctggctccag
tggctgcctcagccccagccccgagtgcggtcccggaagcgccgacgcccccggccccgg
agggccccagtgctctccacccaccacgccgcccgcatctccctgcaccgatggggaggc
tgtggcccccactgccgcctgcgaggagaggccctggtggccctgggccagcccccccgt
gcccgctgggttccccagcaggactggcactgggcccggcgctatgggctgccttacgtg
gtgcgtgtggaccttcgtcgcctggccccagccccaccacccaccccagcccctgctggg
accccaggccccatcctggtcccgaagcaggccctcgccttcgcccccttctccccaccc
aagcgcctacggctggtggtcagccacggttccatcgacctagatgtcgacggggaagag
ctgtga

DBGET integrated database retrieval system