KEGG   Macaca mulatta (rhesus monkey): 700053Help
Entry
700053            CDS       T01028                                 

Gene name
GSTM2
Definition
(RefSeq) glutathione S-transferase mu 2 (muscle)
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    700053 (GSTM2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    700053 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    700053 (GSTM2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    700053 (GSTM2)
   05225 Hepatocellular carcinoma
    700053 (GSTM2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    700053 (GSTM2)
  Drug resistance
   01524 Platinum drug resistance
    700053 (GSTM2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     700053 (GSTM2)
Transporters [BR:mcc02000]
 Other Transporters
  Pores ion channels [TC:1]
   700053 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
1
AA seq 218 aa AA seqDB search
MPMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEKEKIREDILENQLMDNRMQLARLCYDPDF
EKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacactggggtactggaacatccgcgggctggcccactccatccgcctgctc
ctggaatacacaggctcaagttacgaggaaaagaagtacacaatgggggatgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatgggactcacaagatcacccagagcaacgccatcctgcgctacatt
gcccgcaagcacaacctgtgtggggagaccgaaaaggagaagattcgggaagacattttg
gagaaccagcttatggacaaccgcatgcagctggccagactctgctatgacccagatttt
gagaaactgaagccagaatacctggagggacttcctgaaatgctgaagctctactcacag
tttctggggaagcagccatggtttcttggggacaagatcacctttgtggatttcatcgct
tatgatgtccttgagagaaaccaagtatttgagcccagctgcctggatgccttcccaaac
ctgaaggacttcatctcccgatttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttcacaaagatggctgtctggggcaacaagtaa

DBGET integrated database retrieval system