KEGG   Macaca mulatta (rhesus monkey): 700053Help
Entry
700053            CDS       T01028                                 

Gene name
GSTM2
Definition
glutathione S-transferase mu 2 (muscle)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mcc00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mcc00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mcc00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mcc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 218 aa AA seqDB search
MPMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEKEKIREDILENQLMDNRMQLARLCYDPDF
EKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacactggggtactggaacatccgcgggctggcccactccatccgcctgctc
ctggaatacacaggctcaagttacgaggaaaagaagtacacaatgggggatgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatgggactcacaagatcacccagagcaacgccatcctgcgctacatt
gcccgcaagcacaacctgtgtggggagaccgaaaaggagaagattcgggaagacattttg
gagaaccagcttatggacaaccgcatgcagctggccagactctgctatgacccagatttt
gagaaactgaagccagaatacctggagggacttcctgaaatgctgaagctctactcacag
tttctggggaagcagccatggtttcttggggacaagatcacctttgtggatttcatcgct
tatgatgtccttgagagaaaccaagtatttgagcccagctgcctggatgccttcccaaac
ctgaaggacttcatctcccgatttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttcacaaagatggctgtctggggcaacaagtaa

DBGET integrated database retrieval system