KEGG   Macaca mulatta (rhesus monkey): 700178Help
Entry
700178            CDS       T01028                                 

Gene name
GSTM1
Definition
(RefSeq) uncharacterized LOC700178
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    700178 (GSTM1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    700178 (GSTM1)
   00982 Drug metabolism - cytochrome P450
    700178 (GSTM1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    700178 (GSTM1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    700178 (GSTM1)
  Drug resistance
   01524 Platinum drug resistance
    700178 (GSTM1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     700178 (GSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 194 aa AA seqDB search
MSMTLGYWDIRGVSEGPLDGGTRAQGGKQSHQVRDPPSLTRAAGPLSQLAHVIRLLLEYT
DSSYEEKKYFREDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKH
NLCECGLLQCVGGRWPPPWLDWGAMLRKTLCFVGGRWGDRRGEDSCAHYEEPDHGQPYAA
GHDLPQPRICESPQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaccctggggtactgggacatccgaggggtgagcgagggtcccctggacggt
gggaccagggcgcagggtgggaaacaaagtcaccaagtcagggaccctccatctctgacc
cgagctgccggccctctctcccagctggcccacgtcatccgcctgctcctggaatacaca
gactcaagctatgaggaaaagaagtactttagggaggatgctcctgactatgacagaagc
cagtggctgaatgaaaaattcaagctgggcctggactttcccaatctgccctacttgatt
gatgggactcacaagatcacccagagcaacgccatcctgcgctacattgcccgtaagcac
aacctgtgtgagtgtggtttgttgcagtgtgtggggggaaggtggcctcctccttggctg
gattggggtgcgatgctcagaaagactctgtgttttgtgggtggcaggtggggagacaga
agaggagaagattcgtgtgcacattatgaagaaccagaccatggacaaccatatgcagct
ggtcatgatctgccacaacccagaatttgcgagtctccccagtga

DBGET integrated database retrieval system