KEGG   Macaca mulatta (rhesus monkey): 700223Help
Entry
700223            CDS       T01028                                 

Gene name
FLNC
Definition
(RefSeq) filamin C
  KO
K04437  
filamin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    700223 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    700223 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    700223 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    700223 (FLNC)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     700223 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    700223 (FLNC)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   700223 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 2623 aa AA seqDB search
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH
EEEPSEVPQLRQSYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG
EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR
HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP
TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS
IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD
ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI
PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA
VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVP
QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP
VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELD
SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP
QHIVGSPFKAKVTGECWLRGGPSNLQPSPAWRAPVATHIQTIV
NT seq 7872 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcagacgccggcctcggcctgggcgacgagacggacgag
atgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
acattcacgcgctggtgcaatgagcacctcaagtgcgtgggcaagcgcctgaccgacctg
cagcgcgacctcagcgacgggctccggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagttccacccgcgccccaactttcgccaaatgaagctggagaacgtg
tccgtggccctcgagttcctggagcgtgagcacatcaagcttgtgtccatagacagcaag
gccatcgtggatgggaacctgaagctgatccttggcctgatctggacgctgatcctgcac
tactccatctccatgcccatgtgggaggatgaagatgatgaggacgcccgcaaacagaca
cccaagcagcgactgctcggctggatccagaacaaggtgccccagctgcccatcaccaac
ttcaaccgtgactggcaggatggcaaagctctgggtgccctggtggacaactgtgcccct
ggtctctgccccgactgggaggcctgggatcccaaccagcccgtggagaacgcccgagag
gccatgcagcaggccgacgactggcttggggtgccccaggtcattgcccctgaggagatc
gtggaccccaacgtggatgagcattctgttatgacatatctgtcccagttccccaaggcc
aagctcaaacccggcgcccctgttcgatccaagcagctgaaccccaagaaagccatcgcc
tatgggcctggcatcgagccacagggcaacacagtgctgcagcctgcccacttcaccgtg
cagacggtggacgcaggcgtgggcgaggtgctggtctacatcgaagaccctgaaggccac
accgaggaggccaaggtggttcccaacaatgacaaagaccgcacctacgctgtctcctat
gtgcccaaggtcgctgggttacacaaggtgaccgtgctctttgctggccagaacattgaa
cgcagtccctttgaggtgaacgtgggcatggccctgggagatgccaacaaggtgtcagcc
cgtggtcctggcctggaacctgtgggcaatgtggccaacaaacccacctactttgacatc
tacactgcaggggccggcactggcgatgttgctgtggtgatcgtggacccacagggccgg
cgggacacagtggaggtcgccctggaggacaagggtgacagcacgttccgctgcacatac
agacctgtcatggaggggccacacaccgtacatgtggcctttgcgggtgcccccatcacc
cgcagtcccttccctgtccacgtgtcagaagcctgtaaccccaatgcctgccgcgcctct
gggcgaggcctgcagcccaagggtgttcgtgtgaaagaggtggctgacttcaaggtgttt
accaagggtgccggcagcggggagctcaaggtcacagtcaaggggccaaagggcacagag
gagccagtgaaggtgcgggaggctggggacggtgtgttcgagtgcgagtactacccggta
gtgcctgggaagtatgtggtgaccatcacgtggggcggctatgccatccctcgcagcccc
tttgaggtacaggtgagcccagaggcaggagtgcaaaaggtccgggcctggggtcctggt
ttggagactggccaggtgggcaagtcagctgactttgtggtggaagccattggcaccgag
gtggggacactgggcttctccatcgaggggccctcacaagccaagatcgaatgtgatgac
aagggggatggctcctgcgatgtgcggtactggcctacggagcctggggagtacgctgtg
cacgtcatctgtgacgacgaggacatccgagactcacccttcattgcccacatcttgccc
gccccacctgactgcttcccagataaggtgaaggcctttgggcctggcctggagcctaca
ggctgcatcgtggacaagcccgctgagttcaccattgatgcccgtgcagctggcaaggga
gacctgaagctctatgcccaggacgcggacggctgtcccatcgacatcaaggtgatcccc
aacggcgatggcaccttccgctgctcctacgtgcccaccaagcccattaagcacaccatc
atcatctcctggggaggcgtaaacgtgcccaagagccccttccgggtgaacgtgggcgag
ggcagccaccccgagcgggtgaaagtgtacggccccggcgtggagaagacgggcctcaag
gccaacgagcccacctacttcaccgtggactgcagcgaggcagggcaaggtgacgtgagc
attggcatcaagtgcgcccccggcgtggtgggccctgcagaggctgacatcgacttcgac
atcatcaagaatgacaatgacaccttcaccgtcaagtacacgccaccgggggcgggccgc
tacaccatcatggtgctgtttgccaaccaggagatccccgccagccccttccacatcaag
gtggacccatcccacgatgccagcaaagtcaaggccgagggccctgggctgaatcgcaca
ggtgtggaagttgggaagcccacccacttcacggtgctgaccaagggagccggcaaggcc
aagttggatgtgcagtttgcagggacagccaagggcgaggctgtgcgggactttgagatc
atagacaaccatgactattcctacactgtcaagtacaccgctgtccagcagggcaacatg
gcagtgacagtgacctacggcggggaccctgtccccaagagcccctttgtggtgaatgtg
gcacccccgctggacctcagcaaaatcaaagttcagggcctcaatagcaaggtggctgtg
ggacaggaacaagcattctctgtgaacacacgaggggctggcggtcaaggccaactggat
gtgcggatgacttcgccctctcgccggcccatcccctgcaagctggagccaggcggcgga
gcggaagcccaggctgtgcgctacatgcccccggaggaggggccctacaaggtggacatc
acctacgatggtcacccagtgcctggcagcccctttgctgtggagggtgtcctgccccct
gatccctccaaggtctgtgcttacggccccggtctcaagggtggactggtaggcaccccc
gcaccattctctatcgacaccaagggggctggcacaggtggcctggggctgaccgtggag
ggcccctgcgaggccaagatcgagtgccaggacaatggtgatggctcatgtgctgtcagc
tacctgcccacggagcctggcgagtacaccatcaacatcctgtttgccgaagcccacatc
cctggctcgcccttcaaagctaccatccggcccgtgtttgacccaagcaaggtgcgggcc
agtgggccgggcctggagcgcggcaaggccggtgaggcagccaccttcactgtggactgc
tcagaggcaggcgaggcagagctgaccattgagatcctgtcggatgccggggtcaaggcc
gaggtgctgattcacaataatgcggatggcacctaccacatcacctacagccctgccttc
cccggcacctacaccattaccatcaaatatggcgggcatccggtgcccaaattccccacc
cgcgtccatgtgcagcctgcggtcgataccagtggcgtcaaggtctcagggcctggtgtt
gagccacatggtgtcctgcgggaggtgaccactgagttcactgtggatgcaagatcctta
acagccacaggcggcaaccacgtgacggctcgcgtgctcaacccctcgggggccaagaca
gacacttatgtgacagacaatggggacggcacctaccgagtacagtacaccgcctacgag
gagggcgtgcatttggtggaggtcctgtatgatgaggtcgctgtgcccaagagccccttc
cgagtgggtgtcaccgagggctgtgatcccacccgcgtccgggccttcgggccaggcctg
gagggtggcttggttaacaaggccaaccgcttcactgtggagaccaggggagccggcacc
gggggccttggcctagccatcgagggtccctcggaagccaagatgtcctgcaaggacaac
aaggatggtagctgcactgtggagtacatccccttcacccctggagactatgacgtcaac
atcaccttcggggggcggcccatcccagggagcccattccgggtgccggtgaaggatgtg
gtggaccctggaaaggtgaagtgctcggggccagggctgggggctggtgtcagggcccgg
gtcccccagaccttcacagtggactgcagtcaagctggccgggcacccctgcaggtggct
gtgctgggccccacaggtgtggccgagcctgtggaggtgcgggacaatggagatggcacc
cacactgtccactacaccccagccactgatgggccctacacggtagctgtcaagtatgcg
gaccaggaggtgccacgcagccctttcaagatcaaggtccttccagctcatgatgccagc
aaggtgcgagccagcggcccaggcctcaatgcctctgggatccctgccagtctgcctgtg
gagttcaccatcgacgcaagggacgcgggcgaggggttgctcactgtccagatcctggac
cccgagggtaaacccaagaaggccaacatccgggacaatggggatggcacgtacactgtg
tcctacctgccagacatgagcggccggtacaccatcaccatcaagtatggcggcgatgag
atcccctactcacccttccgcatccatgctctgcccaccggggacgccagcaagtgcctc
gtcacagtgtccattggaggccacggcctgggtgcctgcctgggcccccgaatccagatt
gggcaggagacggtgatcacagtggatgccaaggcagccggcgaggggaaggtgacatgc
acggtgtccacgccggatggggcagagctcgatgtggacgtggttgagaaccacgatggt
acctttgacatctactacacagcgcccgagccgggcaagtacgtcatcaccatccgcttc
gggggcgagcacatcccgaacagccccttccacgtactggcgtgtgaccccctgccgcat
gaggaggagccctctgaagtgccacagctgcgccagtcctacgctcctccccggcctggc
gcccgccccacacactgggccacagaggagccagtggtgcctgtggagccaatggaatcc
atgctgaggcccttcaacctggtcatcccctttgcggtgcagaaaggggagctcacagga
gaggtgcggatgccctcagggaagacggcgcggcccaacatcaccgacaacaaggacggc
accatcacggtgaggtacgcacccaccgagaaaggcctgcaccagatggggatcaagtat
gacggcaaccacatccctgggagccccttgcagttttatgtagatgccatcaacagccgc
catgtcagtgcctatgggccaggcctgagccatggcatggtcaacaagccagccaccttc
accattgtcaccaaagatgctggagaagggggtctgtcgctggccgtggagggcccatcc
aaggcagagatcacctgtaaggacaacaaggatggcacctgcaccgtgtcctacctgccg
accgcacctggagactacagcatcatcgtgcgcttcgatgacaagcacatcccggggagc
cccttcaccgccaagatcacaggcgatgactccatgaggacctcacagctgaacgtgggt
acctccacggatgtgtcgctgaagatcaccgagagtgatctgagccagctaaccgccagc
atccgtgccccctcgggcaacgaggagccctgtctgctgaagcgcctgcccaaccggcac
atcgggatctccttcactcccaaggaggtgggggagcatgtggtgagcgtgcgcaagagt
ggcaagcacgtcaccaacagccccttcaagatcctggtggggccatctgagatcggggac
gccagcaaggtgcgggtctggggcaagggcctttctgagggacacacgttccaggtggcg
gagttcatcgtggatactcgcaatgcagggtatgggggcttggggctgagtattgaaggc
ccaagcaaggtggacatcaactgtgaggacatggaggacgggacatgcaaagtcacctac
tgccccaccgagcccggcacctatatcatcaacatcaagtttgctgacaagcacgtgcct
ggaagccccttcactgtgaaggtgaccggcgagggccgcatgaaggaaagcattacccgg
cggagacaggcgccttccatcgccaccattggcagcacctgtgacctcaacctcaagatc
ccagggaactggttccagatggtgtctgcccaggagcgcctgacgcgcaccttcacacgc
agcagccacacctacacccgcacggagcgcacggaaatcagcaagacgcggggcggggag
acaaagcgcgaggtgcgggtggaggagtccacccaggtcggcggggaccccttccctgct
gtgtttggggacttcctgggccgggagcgcctgggctccttcggcagcatcacccggcag
caggagggcgaggccagctctcaggacatgactgcacaggtgaccagcccatcgggcaag
atggaagccgcggagatcgtcgagggcgaggacagcgcctacagtgtgcgctttgtgccc
caggagatggggccccatacggtcgctgtcaagtaccgtggccagcacgtgcccggcagc
ccctttcagttcactgtggggccgctaggtgaaggcggggcccacaaggtgcgggccgga
ggcacagggctggagcgaggtgtggccggcgtgccagccgagttcagcatctggacccgg
gaggccggtgctgggggcctgtccattgctgtggagggtcctagcaaggcggagattgca
tttgaggatcgcaaagatggctcctgcggcgtctcctatgttgtccaggaaccaggtgac
tatgaggtctccatcaagttcaatgatgagcacatcccggacagtccctttgtggtgcct
gtggcctccctctcggatgacgctcgccgtctcaccgtcaccagcctccaggagacaggg
ctcaaggtgaaccagccggcgtcctttgctgtgcagctgaacggcgcacggggcgtgatt
gatgcccgggtgcacacaccctcgggggctgtggaggagtgctacgtctctgagctagac
agtgacaagcataccatccgcttcatcccccacgagaatggcgtccactccattgatgtc
aagttcaatggtgcccacatccctggaagtcccttcaagatccgcgttggggagcagagc
caggctggggacccaggcttggtgtcagcctatggtcctgggctcgagggaggcactact
ggtgtgtcatcagagttcatcgtgaacaccctgaacgccggctcgggggccttgtctgtc
accattgatggcccctccaaggtgcagctggactgtcgggagtgtcctgagggccacgtg
gtcacttacactcccatggcccctggcaactacctcattgccatcaagtacggtggcccc
cagcacatcgtgggcagccctttcaaggccaaggtcactggtgagtgctggcttcgggga
ggcccatccaacctgcagcccagcccagcctggagggctccggtggccacgcacatccag
accatagtctga

DBGET integrated database retrieval system