KEGG   Macaca mulatta (rhesus monkey): 700235Help
Entry
700235            CDS       T01028                                 

Gene name
USP38
Definition
ubiquitin specific peptidase 38 (EC:3.4.19.12)
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     700235 (USP38)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   700235 (USP38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1041 aa AA seqDB search
MDKILEGLVSSSHPLPLKRVIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPQLCARLSDLLTDFVQCIPKGKLSITFCQQLVRTIGHFQC
VSTQERELREYVSQVTKVSNLLQNIWKAEPTTLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVNLVH
SFKNDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS
AWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEE
KILKVQSSHKPSEILECSETSLQEVASKAAVLTETPRTTDSEKTLIEKMFGGKLRTHICC
LNCRSTSQKVEAFTDLSLAFCPSSLENMSFQDPASSPSTQDGGLMQAAIPSPSEEPVVYN
PTTAAFICDSVVNERTIGSPPNEFYCSENTSVPNESNRILVNKDVPQKPGGETTPSVTDL
LNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKIL
DNVSLPLVLELPVKRTTSFSSLSESWSVDVDFTDLSENLAKKLKPSGTDEASCTKLVPYL
LSSVVVHSGISSESGHYYSYARNITGTESSYQIYHQSEALALASSQSHLLGRESPSAVFE
QDLENKEMSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQHSTNGLSGNNPT
SGLWINGDPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPPG
SCGPTGGGGGGGFNTVGRLVF
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggagggccttgtgagttcttcgcatcccctgcccctcaagcgggtg
attgtgcggaaggtggtggaatcggcggagcactggctagacgaggcgcagtgcgaggcc
atgtttgacctgacgacccggctcatcctggagggccaggaccctttccagcggcaggtg
gggcaccaggtgctggaggcctacgcacgataccaccggccagagttcgagtccttcttc
aacaagacctttgtgttgggcctccttcatcagggctaccactctctggacaggaaggat
gtagccatcctggactacattcacaacggcctgaagctgattatgagctgtccgtcggtg
ctggatctcttcagcctcctgcaggtagaggtgttacggatggtgtgtgagagaccggag
ccgcagctctgtgcccgactgagcgaccttctgaccgacttcgtgcaatgcatccccaaa
gggaaattgtccatcacgttctgtcaacagctggttcgaacgataggccacttccagtgc
gtgtccactcaggagagagagttgcgggaatatgtctcccaggtgacaaaagtgagtaac
ttgctgcagaacatctggaaggccgagcctaccacactgctgccttctctgcaggaagtt
tttgcaagcatctcttccacagatgcatcatttgaaccttctgtagcattggcaagcctt
gtgcagcatattcctcttcagatgattacagttctcatcaggagccttactacagatcca
aatgtaaaagatgcaagtatgacccaagccctttgcagaatgattgactggctatcctgg
ccattggctcagcatgtggatacatgggtaattgcactcctgaaaggactggcagctgtc
cagaagtttactattttgatagatgttactttgctgaaaatagaactggtttttaatcga
ctttggtttcctcttgtgagacctggtgctcttgcagttctttctcacatgctgcttagc
tttcagcattctccagaggcgttccatttgattgttcctcatgtggttaatttggttcat
tctttcaaaaatgatggtctgccttccagtacagccttcttagtacaattaacagaattg
atacactgtatgatgtatcattattctggatttccagatctctatgaacctattctggaa
gcaataaaggattttcctaagcccagtgaagagaagattaagttaattctcaatcaaagt
gcctggacttctcaatccaattctttggcatcttgcttgtctagactttctggaaaatct
gaaactgggaaaacaggtcttattaacctaggaaatacatgttatatgaacagtgttata
caagccttgtttatggccacagatttcaggagacaagtattatctttaaatctaaatggg
tgcaattcattaatgaaaaaattacaacatctttttgcctttctggctcatacacagagg
gaagcatacgcacctcggatattctttgaggcttccagacctccatggtttactcccaga
tcacagcaagactgttctgaatacctcagatttctccttgacaggctccatgaagaagaa
aagatcttgaaagttcagtcctcacacaagccttctgaaattctggaatgcagtgaaact
tctttacaggaagtagctagtaaagcagcagtactaacagagacccctcgtacaactgac
agtgagaagactttaatagaaaaaatgtttggaggaaaattacgaactcacatatgttgt
ttgaactgcaggagtacctcacaaaaagtggaagcctttacagatctttcgcttgccttt
tgtccttcctctttggaaaacatgtctttccaagatccagcatcatcacccagtacacaa
gatggtggtctaatgcaagccgctatacccagtccttcagaagaaccagtagtttataat
ccaacaacagctgccttcatctgtgactcagttgtgaatgaaagaaccataggcagtcct
cctaatgagttttactgttctgaaaacacttctgtccctaacgaatctaacaggattctt
gttaataaagatgtacctcagaaaccaggaggtgaaaccacaccttcagtaactgactta
ctaaattattttttggctccagagattcttactggtgataaccaatattattgtgaaaac
tgtgcctctctgcagaatgctgagaaaactatgcaaatcacagaggaacctgaatacctt
attcttactctcctgagattttcgtatgatcagaagtatcatgtgagaaggaaaatttta
gacaatgtatcactgccactggttttggagttgccagttaaaagaactacttctttctct
tcattgtcagaaagttggtctgtagatgttgacttcactgatcttagtgagaaccttgct
aaaaaattaaagccttcagggactgatgaagcttcctgcacaaaattggtgccctatcta
ttaagttctgttgtggttcactctggtatatcctctgaaagtgggcattactattcttat
gccagaaatatcacaggtacagagtcttcatatcagatataccaccagtctgaggctctg
gcattagcatcctcccagagtcatttactagggagagagagtcccagtgcagtttttgaa
caggatttggaaaataaggaaatgtcaaaagaatggtttttatttaatgacagtagagtg
acatttacttcatttcagtcagtccagaaaattacaagtaggtttccaaaggacacagct
tatgtgcttttgtataaaaaacagcatagtactaatggtttaagtggtaataacccaacc
agtggactctggataaatggagacccacctctgcagaaagaacttatggatgctataaca
aaagacaataaactatatttacaggaacaagagttgaatgctcgagcccgggccctacaa
gctgcatctgcttcatgttcatttcggcccaatggatttgatgacaatgacccaccagga
agctgtggaccaactggtggagggggtggaggaggatttaatacagttggcagactcgta
ttctga

DBGET integrated database retrieval system