KEGG   Macaca mulatta (rhesus monkey): 700254Help
Entry
700254            CDS       T01028                                 

Gene name
WHSC1L1
Definition
(RefSeq) Wolf-Hirschhorn syndrome candidate 1-like 1
  KO
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    700254 (WHSC1L1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     700254 (WHSC1L1)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     700254 (WHSC1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 1447 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPPLTNGYPSSISVYETQTKYQSYSQYPNGSANGFGAARNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
DPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKNVASKTEVKKTR
RPRSVLNTQPEQTSAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRSEKPTQSISSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSD
LQVGFGKQVDSPSATADADVSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGE
CCKHFHLECLGLTSLPDSKFVCMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVR
KFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSMLV
SSYILICSNHSKRSSNSSAAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRA
ELMKLPMIPSSSASKKKCEKVIKTVYLFQGGRLLCCESCPASFHPECLSIEMPEGCWNCN
DCKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYW
VHQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKP
PPYKHIKANKVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPA
GDRCQNQCFTKRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKR
AHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCD
IPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTTEEKAKNAKLKQKRR
KIKTEPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDEC
SSAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAPVSPEYWSKIKCKWESQD
HGEEVKE
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atggatttctctttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
caactcattgactccgccaacatccgtcaggaggatgcctttgataacaacagtgacatt
gctgaagatggtggccaaacaccatatgaagctaccttgcagcaaggctttcagtaccca
gctacaacagaagatcttcctccactcacaaatgggtatccatcatcaatcagcgtgtat
gaaactcaaaccaaataccagtcatatagtcagtatcctaatgggtcagccaatggcttt
ggtgcagctagaaactttagccccactgactattaccattcagaaattccaaacacaaga
ccacatgaaattctggaaaaaccttcccctccacagccaccacctcctccttcggtacca
caaactgtgattccaaagaagactggctcacctgaaattaaactaaaaataaccaaaact
atccagaatggcagggaattgtttgagtcttccctttgtggagaccttttaaatgaagta
caggcaagtgagcacacgaagtcaaagcatgaaagcagaaaagaaaagaggaaaaaaagc
aacaagcatgactcatcgagatctgaagagcgcaagtcacacaaaatccccaaattagaa
ccagaggaacaaaatagaccaaatgagagggttgacactgtatcagaaaaaccaagggaa
gatccagtactaaaagaggaagccccagttcagccaatactatcttctgttccaacaaca
gaagtgtccactggtgttaagtttcaggttggcgatcttgtgtggtccaaggtgggaacc
tatccttggtggccttgtatggtttcaagtgatccccagcttgaggttcataccaaaatt
aacacaagaggtgcccgagaatatcatgtccagttttttagcaaccagccagagagggca
tgggttcatgaaaaacgggtacgggagtataaaggtcataaacagtatgaagaattactg
gctgaggcaaccaaacaagccagcaatcactctgagaaacaaaagattcggaaaccccga
cctcagagagaacgtgctcagtgggatattggtattgcccatgcagagaaagcattgaaa
atgactcgagaagaaaggatagaacagtatacttttatctatattgataaacagcctgaa
gaggctttatcccaagcaaaaaagaatgttgcctccaaaaccgaagttaaaaaaactcga
cgaccaagatctgtgctgaatactcagccagaacagaccagtgcaggggaggtggcctcc
tcactctcaagtactgaaattcggagacacagccagaggcggcacacaagtgcggaagag
gaagagccacctcctgttaaaatagcctggaaaactgcggcagcaaggaaatccttacca
gcttccattacgatgcacaaagggagcctggatttgcagaagtgtaacatgtctccagtt
gtgaaaattgaacaagtgtttgctcttcagaatgctacaggggatgggaaatttatcgat
caatttgtttattcaacaaagggaattggtaacaaaacagaaataagtgtcagggggcaa
gacaggcttataatttctacaccaaaccagagaagtgaaaagccaacgcagagtatatca
tctcctgaagcaacatctggttctacaggctcagtagaaaagaagcaacagagaagatca
attagaactcgttctgaatcagagaaatccactgaggttgtgccaaagaagaagatcaaa
aaggagcaggttgaaacagttcctcaggctacagtgaagactggattacagaaaggtgcc
agcgagatttcagattcctgtaaacctctaaagaaaaggagtcgcgcctcaactgatgta
gaaatgactagttcagcatacagagacacatctgactccgattctagaggactgagtgac
ctgcaggtaggctttggaaagcaagtagatagcccttcagctactgcagatgcagacgtt
tctgatgtgcagtccatggattcaagtttgtccagaagaggcactggaatgagtaagaag
gacactgtatgtcagatttgtgaaagctctggtgactctctgattccttgtgagggagag
tgctgcaaacactttcacctggagtgcctgggattgacatcactccctgatagcaagttc
gtctgcatggaatgtaaaaccgggcagcacccatgtttctcgtgtaaagtgtctggtaaa
gatgtgaagcgttgttctgttggtgcttgtgggaaattttatcatgaagcctgtgtccgc
aaattccccactgccatctttgaatcaaaaggattccgctgtcctcagcactgctgctct
gcctgctctatggagaaagatatccacaaagcaagtaaaggccgcatgatgagatgtttg
agatgtccagttgcctatcactctggagatgcttgcattgcggctggaagcatgttagta
tcctcctacattctcatctgtagtaatcattccaaacggagcagtaattcttctgctgct
gtaaatgtaggcttttgtttcgtttgtgccagagggctgatagttcaggaccattcagac
cccatgttcagttcatatgcctataagtcccactatctactgaatgaatcaaatcgtgct
gagttgatgaaattacctatgattccttcttcgtcagcttccaaaaagaaatgtgagaaa
gttattaagactgtttatttgtttcaaggtggaagattgctctgctgtgaatcgtgccca
gcttccttccacccggaatgcctgagcatagaaatgccagaaggctgctggaattgtaat
gactgtaaagctggcaagaaactacattacaagcagattgtttgggtcaaattgggaaat
tacagatggtggccagcagagatctgcaaccccaggtctgtgccactgaacatccagggc
cttaaacatgacttgggggacttccctgtgttcttctttggttctcatgactactactgg
gtacaccagggcagagtgttcccttatgttgaaggagacaaaagctttgctgaggggcag
actagtattaacaagaccttcaaaaaagcactggaagaagctgcaaaacgtttccaggaa
ttgaaagcacaaagagagagtaaagaagccctagagattgaaaaaaactcaagaaaaccc
cctccctacaaacacatcaaagctaacaaagtaataggaaaggtgcagatccaggttgct
gacctgtcagagattccccgctgtaactgcaagccagctgatgaaaacccttgtggcttg
gaatcagagtgcctgaacagaatgttgcagtacgaatgccacccacaggtgtgcccagct
ggagatcgttgtcagaaccagtgcttcacaaagagactgtaccctgatgcagagatcatc
aaaacagagcggagaggctggggcctcaggaccaaaaggagcattaagaagggtgaattt
gtaaatgaatacgtcggtgaattaattgatgaagaagaatgcagattgcgaatcaagcga
gcccacgagaacagtgtaactaatttttatatgttaactgttaccaaggatcgtataatt
gatgccggccccaaaggaaattattctcgcttcatgaaccacagttgtaatcccaactgt
gaaacacaaaagtggacagtgaatggagatgttcgagtgggactgtttgctctctgtgat
attcctgcagggatggagttaacatttaattataacctagattgtctgggcaacggcaga
acggagtgccactgtggggcagataactgcagtggttttctaggagtgcggccaaagtcg
gcatgtgcgtcaacaactgaagagaaggcgaaaaatgctaagttaaaacagaagagacga
aagatcaaaacagaaccaaagcagatgcatgaagattactgttttcagtgtggagatggt
ggagagctggtcatgtgtgacaaaaaagactgtcccaaagcataccacctcctatgcctt
aacctgactcagccaccatatggaaagtgggagtgtccgtggcatcagtgcgatgagtgc
agcagtgcagctgtttccttctgtgagttctgtccacattcattttgtaaagatcatgaa
aagggggccctggttccctccgcactggaaggccgcctctgctgctcggaacatgacccc
atggctcctgtgtcaccagaatactggagcaagataaaatgtaaatgggaatcacaggat
catggagaagaagtaaaagaataa

DBGET integrated database retrieval system