KEGG   Macaca mulatta (rhesus monkey): 700444Help
Entry
700444            CDS       T01028                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 663 aa AA seqDB search
MAPKRAVQLSLKMPTHAVCVVGVSAHVDVHSDVPKGANSFRVSGSSGVEIFMVYNRTHVT
EPIGKARWPLDTDADMVVSVGTASKELRDFKVRVSYYGEQEDQALGHSMLYLTGVDISLE
VDTGRTGKVKRSQGDKKTWRWGPEGYGAILLVNCDRDNHRSTEPDLTHSWLMSLADLQDM
SPMVLSCNGPDELFDSHKLVLNMPVSDSKRLRVFCARGGNSLSDYKQVLGPQRLSYEVER
QSGEQEIRFYVEGLTFPDADFLGLVSLSVSLVDTGTVPEVTLFTDTVGFRMAPWIMTPNT
QPPEELYVCSVMDTHGSNEKFLEDMSYLTLKANCKLIICPRVENRNDRWIQDEMEFGYIE
APHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLSGPSSLDSFGNLDVSPPVTV
GSMEYPLGRILIGSSYPKSGGRQMARVVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFV
PTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKISINEMLADRHLRRDN
LHAQKCIDWNRNVLKRELGLAESDIVDIPQLFLLKNFYAEAFFPDMVNMVVLGKYLGIPK
PYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLSYHELQGEIHCGTNVRRKPFPFKWWN
MVP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaagagagctgtgcagctgtccctgaagatgcctacccatgccgtgtgtgta
gtgggagtctcggcacatgtggacgttcacagcgatgtgcccaagggtgccaacagcttc
agggtctctggaagctccggggtggagatcttcatggtctacaaccgcacacacgtgaca
gagcccataggcaaggcccgttggccactggacactgatgcagacatggtcgtatctgtg
ggcacagccagtaaggaattaagggacttcaaggtgagggtctcatactatggggagcag
gaagaccaagccctgggccacagcatgctgtacctcactggcgtcgatatttcccttgag
gtcgacacaggccgcacaggcaaggtgaagagaagccagggggacaagaaaacctggcgc
tggggccctgagggctatggggctatcttgctggtgaactgtgaccgggacaatcacagg
tccacagagcctgacctcacccacagctggctgatgtcgctggctgacttgcaggacatg
tccccgatggtgctgagctgcaatggccccgatgagctcttcgacagccacaagcttgtc
ttgaacatgcccgtctctgattccaaaagactgagggtcttctgtgctcggggtgggaat
tctctctcggactacaagcaggtgctggggccccagcgtctgtcctacgaagttgagcgg
cagtcgggggagcaggagatcaggttctatgtggaggggctgaccttccccgatgccgat
ttcctggggctggtttccctcagtgtcagcctggtggacacggggaccgtgcctgaggtg
accctcttcacagacactgtgggcttccgcatggccccctggatcatgacgcccaacact
cagcctcctgaggagctgtatgtgtgcagtgtgatggacactcacggctctaatgagaaa
ttcttggaggacatgtcttacctgacgttgaaagccaactgcaagctgatcatctgccct
cgagttgaaaatcgaaatgaccgctggatccaggacgagatggagtttggctacatcgag
gcccctcacaaatccttccccgtggtctttgactccccccggaacagaggcctgaaggat
ttcccctataagaggatcctgggtcctgactttggatatgtgacccgggagatcccactc
tctggtccctccagccttgactccttcggcaacctggacgtcagtccacctgtcacggtg
ggcagcatggagtaccccctgggccggatcctcatcgggagcagctaccccaagtccggc
gggcggcagatggccagggtggtgcggaacttcctgaaggcccagcaggtgcaggcaccc
gtggagctctactcggactggctctctgtgggccatgtggacgagttcctgacctttgtg
cctacctctgaccaaaagggcttccggctgctcctggctagccctagcgcctgcctcaaa
ctcttccaagagaagaaagaagagggctatggcgaggcagcccagtttgatgggttaaaa
caccaggcaaaaataagcattaatgagatgctggcagacagacacctccggagagacaat
cttcatgcacagaaatgcattgactggaaccgtaatgtactgaagcgggaactgggcctg
gcagagagtgacatcgtggatattcctcagctcttcctcctgaaaaacttctatgcagaa
gccttcttcccagacatggttaacatggtggtcttaggcaagtacctgggcatccccaag
ccctacgggcccatcatcaacggccgctgctgcctcgaggagaaggtgcagtccctgctg
gaacctctgggcctgcactgcatcttcattgatgactacttgtcctaccacgagctgcag
ggcgagatccactgtggcaccaacgtgcgcaggaagccctttcccttcaaatggtggaac
atggtgccctga

DBGET integrated database retrieval system