KEGG   Macaca mulatta (rhesus monkey): 700454Help
Entry
700454            CDS       T01028                                 

Gene name
ITGB6
Definition
(RefSeq) integrin subunit beta 6
  KO
K06589  integrin beta 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy (HCM)
mcc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mcc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    700454 (ITGB6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    700454 (ITGB6)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    700454 (ITGB6)
  Cell motility
   04810 Regulation of actin cytoskeleton
    700454 (ITGB6)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    700454 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    700454 (ITGB6)
   05414 Dilated cardiomyopathy (DCM)
    700454 (ITGB6)
  Infectious diseases
   05165 Human papillomavirus infection
    700454 (ITGB6)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   700454 (ITGB6)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin beta subunits
   700454 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 700454
NCBI-ProteinID: XP_014965715
Ensembl: ENSMMUG00000002678
UniProt: A0A1D5QZT0
Position
12
AA seq 788 aa AA seqDB search
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTRPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTFFQHQKKCSHMKVGDTASFNVT
VNIPNCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG
KCVCANPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEE
DFSKDGSVSCSLQGENECLITFLITTDNEGKSIIHSISEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDG
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgctcattggacctcag
tgtgcctggtgtgctcaggagaattttacccgtccatctggagttggtgaaaggtgtgat
accccagcaaaccttttagctaaaggatgtcaattaaacttcatcgaaaaccctgtctcc
caagtagaaatacttaaaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcacctcaaagcttgatccttaagttgagaccaggtggtgcgcagact
ctgcaggtgcatgtccgccagactgaggactacccggtggatttgtattacctcatggac
ctctccgcctccatggatgatgacctcaacacaatcaaggagttgggctcccggctttcc
aaagagatgtctaaattaaccagcaactttagactgggcttcggatcttttgtggaaaaa
cctgtatccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacttctgtttacctacatttggattcaagcacattttgccattgacaaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatatcgacacacctgaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggttggcggaat
gattccctccacctcctggtctttgtgagtgatgctgattctcattttggaatggacagc
aaactggcaggcatcgtcattcctaatgatgggctctgtcacttggacagcaagaatgaa
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggta
caaaacaacgtgttattgatcttcgctgtaacccaagaacaagttcatttatatgagaat
tacgcaaaacttattcctggagctacagtagggctacttcagaaggactccggaaacatt
ctccagctgatcatctcagcttatgaagaactgcggtctgaggtggaactggaagtatta
ggagacactgaaggactcaacttgtcatttacagccatctgtaacaacggtacattcttc
caacaccaaaagaaatgctctcacatgaaagtgggagacacagcttccttcaatgtgact
gtgaatatcccaaactgtgagagaagaagcaggcacattatcataaagcctgtgggactg
ggggacgccctggaattacttgtcagtccagaatgcaactgcgactgtcagaaagaagtg
gaagtgaacagctccaagtgtcaccacgggaacggctccttccagtgtggggtgtgtgcc
tgccaccctggccacatggggcctcgctgtgagtgtggcgaggacatgctgagcacagat
tcctgcaaggaggccccagatcatccctcctgcagtggaaggggtgactgctactgtgga
cagtgtatctgccacttgtctccctatggaaacatttatgggccttattgccagtgtgac
aatttttcctgcgtgagacacaaagggctgctctgcggagacaacggcgactgtgactgt
ggtgagtgtgtatgcaggagcggctggactggcgagtactgcaactgcaccaccagcacg
gactcctgcgtctctgaagacggagttctctgcagcgggcgtggggactgcgtttgtggc
aagtgtgtttgcgcaaacccgggagcctcaggaccaacctgtgaacgatgtcctacctgt
ggtgacccctgtaactctaaacggagctgcattgagtgccacctgtcagcagctggccaa
gcccgagaagaatgtgtggacaagtgcaaactagctggtgcgaccatcagtgaagaagaa
gatttctcaaaggatggttctgtttcctgctctctgcaaggagaaaatgaatgtcttatt
acattcctgataactacagataatgaggggaaaagcatcattcacagcatcagtgaaaaa
gattgtccaaagcctccaaacattcccatgatcatgttgggggtttccctggctattctt
ctcatcggggttgtcctgctgtgcatctggaagctgctggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacggtcaaaagccaagtggcaaacgggaaccaatcca
ctctacagaggctccacgagtacttttaaaaatgtaacttataaacacagggaaaaacaa
aaggtggacctttccacagatggatag

DBGET integrated database retrieval system