KEGG   Macaca mulatta (rhesus monkey): 700485Help
Entry
700485            CDS       T01028                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Human Diseases; Cancers; Pathways in cancer [PATH:mcc05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:mcc05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:mcc05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 458 aa AA seqDB search
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAK
WESEYMSSDRMVPSPPLPKPKPRVYKPCFICQDKSTGFHSGVGACGSGAGCKGFFRRSIQ
KNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTES
YEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCII
KIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQM
HNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLE
ALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENS
EGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccactagcggccacgcatgtccggtcccagcagtgaatggacacatgactcactat
ccagccacaccctacccattactttttccacctgtcatcggaggactttccctgcctccc
ctccatggccttcatggacatccgcctccgagtgggtgcagcaccccatcaccagcaaaa
tgggaatcagaatacatgtccagtgaccgtatggtgccctcgccaccgctccccaagccc
aaaccccgtgtttataaaccttgttttatctgccaagacaagagtactgggtttcactca
ggggtgggggcatgtgggagtggtgctgggtgcaagggctttttccgcagaagtattcag
aagaatatgatttacacttgtcaccgagataagaactgtgttattaataaagtcaccagg
aatcgatgccaatactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatct
gtcaggaatgacaggaacaagaaaaagaaggagacttcgaagcaagaatgcacagagagc
tatgaaatgacagctgagctggacgatctcacagagaagatccgaaaagctcaccaggaa
acttttccttcgctctgccagctgggtaaatacaccacgaattccagtgctgaccatcga
gtccgactggacctgggcctctgggacaaattcagtgaactggccaccaagtgcattatt
aagatcgtggagtttgctaaacgtctgcctggtttcactggcttgaccattgcagaccaa
atcaccctgctgaaggccgcctgcctggacatcctgattcttagaatttgcaccaggtat
accccagaacaagacaccatgactttttcagacggccttaccctaaatcgaactcagatg
cacaatgctggatttggtcctctgactgaccttgtgttcacctttgccaaccagctcctg
cctttggaaatggatgacacagaaacaggccttctcagtgccatctgcttaatctgtgga
gaccgccaggaccttgaggaaccgacaaaagtagataaactacaagaaccattgctggaa
gcactaaaaatttatatccgaaaaagacgacccagcaagcctcacatgtttccaaagatc
ttaatgaaaatcacagatctccgtagcatcagtgctaaaggtgcagaacgtgtaattacc
ttgaaaatggaaattcctggatcaatgccacctctcattcaagaaatgctggagaattct
gaaggacatgaacccttgaccccaagttcaagtgggaacacagcagagcacagtcctagc
atctcacccagctcagtggaaaacagtggggtcagtcagtcaccacttgtgcaataa

DBGET integrated database retrieval system