KEGG   Macaca mulatta (rhesus monkey): 700806Help
Entry
700806            CDS       T01028                                 

Gene name
PADI4
Definition
protein-arginine deiminase type-4-like
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     700806 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 586 aa AA seqDB search
MAQGTLIRVTPEQPTHAVCVLGTLTQLDVCSSAPEDCTSFSVNASPGVVVDIAHSPPAKK
KSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYHGPKTPPVKALLYLTGVEISLSAD
ITRTGKVKPTRAVEDKRTWTWGPCGQGAILLVNCDRDNPESSAMDCEDDEVLDSKDLKDM
SLMTLSTKTPQDFFTRHTLVLHVARSEMDKVRVFQATRRASKSRALRSCFSALSSIFENE
DFLKSVTALAMQARCKLTICPEEENMDDQWMQDEMEIGYIQAPHKTLPVVFDSPRNRGLK
EFPIKRVMGPDFGYVTRGPQTGGVSGLDSFGNLEVSPPVTVGDKEYPLGRILFGDSCYPS
SDSREMHQALQDFLSAQQVQAPVKLYSDWLTVGHVDEFLSFVPAPDRKGFRLLLASPRSC
YKLFQEQQNEGHGDALLFQGIKKKNQQKIKNILSNTTLREHNSFVERCIDWNRELLKREL
GLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPIINGRCCLEEKVC
SLLEPLGLHCTFINDFYTYHIRHGEVHCGTNVRRKPFSFKWWNMVP
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggacattgatccgtgtgaccccagagcagcccacccatgccgtgtgtgtg
ctgggcaccttgactcagcttgacgtctgcagctctgcccctgaggactgcacgtccttc
agcgtcaacgcctctccaggggtggtcgtggatattgcccacagccctccagccaagaag
aagtccacaggttcctccacatggcccctggaccctggggtagaggtgaccctgacgatg
aaagcagccagtggtagcacaggcgaccagaaggttcagatttcataccatggacccaag
actccaccagtcaaagctctactctatctcaccggggtggaaatctccctgagcgcggac
atcacccgcaccggcaaagtgaagccaaccagagctgtggaagacaagaggacctggacc
tggggcccttgtggacagggtgccatcctgctggtgaactgtgacagagacaatcctgaa
tcttctgccatggactgtgaggatgacgaagtgcttgacagcaaagacctgaaggacatg
tccctgatgaccctgagcacgaagaccccccaggacttcttcactaggcatacactggtg
ctccacgtggccaggtctgagatggacaaagtgagagtgtttcaggccacacgccgagct
tcaaaatccagagcactaaggagctgtttttctgctctctctagtatttttgaaaatgag
gacttcctgaagtcagtgactgctctggccatgcaagccaggtgtaagctgaccatctgc
cctgaggaggagaacatggatgaccagtggatgcaggatgaaatggagatcggctacatc
caagccccacacaaaacgctgccggtggtatttgactctccaaggaacagaggcctgaag
gagtttcccatcaaacgtgtgatgggtccagattttggctacgtaactcgagggccccaa
acagggggtgtcagtgggctggactcctttgggaacctggaagtgagccccccggtcaca
gtcggggacaaggaatacccgctgggcaggattctctttggggacagctgttatcccagt
agtgacagccgggagatgcaccaggccctgcaggacttcctaagcgcccagcaggtgcag
gcccctgtgaagctctattctgactggctgaccgtgggccacgtggacgagttcctgagc
tttgtgcctgcacctgacaggaagggcttccggctgctcctggccagccccaggtcctgc
tacaaactgttccaggagcagcagaatgagggccacggggatgccctgctgttccaaggg
atcaagaaaaaaaaccagcagaaaataaagaacattctgtcaaacacgacattgagagaa
cataattcatttgtggagagatgcattgactggaaccgcgagctgctgaagcgggagctg
ggcctggctgagagtgacatcatcgacattccgcagctcttcaagctcaaagagttctcc
aaggccgaagcctttttccccaacatggtgaacatgctggtgctggggaagcacctgggc
atccccaagccctttgggcccatcatcaacggccgctgctgcctggaggagaaggtgtgt
tccctgctggagcctctgggcctccactgcactttcatcaatgacttctacacctaccac
atcaggcatggggaggtgcactgcggcaccaatgtgcgcagaaagcccttctccttcaag
tggtggaacatggtgccctga

DBGET integrated database retrieval system