KEGG   Macaca mulatta (rhesus monkey): 700883Help
Entry
700883            CDS       T01028                                 

Gene name
USP17L10, USP17
Definition
ubiquitin specific peptidase 17-like family member 10
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 530 aa AA seqDB search
MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSSETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSPTCHRH
KGCMLCTMQAHITRALHIPGRVIQPSQALAADFHRGKQEDAHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVKQALEQL
VKPEELNGENAYHCGLCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGSKLAKNVHYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSIT
SVLSQQAYVLFYIQKSEWERHSESASRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
DEHLVERATQESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHP
EQQSSPLNLSSTTPTDQESVNTGTLASLQGRTRRSKGKNKHSKRALLVCQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgactcactctacttgggaggtgagtggcagttcaaccacttttcaaaactc
acatcttctcggccagatgcagcttttgctgaaatccagcggacttctctccctgagaag
tcaccactctcatctgagacccgtgtcgacctctgtgatgatttggctcctgtggcaaga
cagcttgctcccagggagaagcttcctctgagtagcaggagacctgctgcggtgggggct
gggctccagaatatgggaaatacctgctacgtgaacgcttccctgcagtgcctgacgtac
acaccgccccttgccaactacatgctgtcccgggagcactctccaacgtgtcatcgtcac
aagggctgcatgctctgtactatgcaagctcacatcacacgggccctccacattcctggc
cgtgtcatccagccctcacaggcattggctgctgacttccatagaggcaagcaggaagat
gcccatgaatttctcatgttcactgtggatgccatgaaaaaggcatgccttcccgggcac
aagcaggtagatcatcactctaaggacaccaccctcatccaccaaatatttggaggctac
tggagatctcaaatcaagtgtctccactgccacggcatttcagacacttttgacccttac
ctggacatcgccctggatatccaggcagctcagagtgtcaagcaagctttggaacagttg
gtgaagcccgaagaactcaatggagagaatgcctatcattgtggtctttgtctccagagg
gcgccggcctccaagacgttaactttacacacttctgccaaggtcctcatccttgtattg
aagagattctccgatgtcacaggcagcaaacttgccaagaatgtgcactatcctgagtgc
cttgacatgcagccatacatgtctcagcagaacacaggacctcttgtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacaacggacattacttctcttatgtcaaa
gctcaagaaggccagtggtataaaatggatgatgccgaggtcaccgcctctagcatcact
tctgtcctgagtcaacaggcctatgtcctcttttacatccagaagagtgaatgggaaaga
cacagtgagagtgcgtcaagaggcagggaaccaagagcccttggcgctgaagacacagac
aggcgagcaacgcaaggagagctcaagagagaccacccctgcctgcaggcacccgagttg
gacgagcacttggtggaaagagccactcaggaaagcaccttagaccactggaaattcctt
caagagcaaaacaaaacgaagcctgagttcaacgtcagaaaagtcgaaggtaccctgcct
cccaacgtacttgtgattcatcaatcaaaatacaagtgtgggatgaagaaccatcatcct
gaacagcaaagctccccgctaaacctctcttcgacgaccccgacagatcaggagtccgtg
aacactggcacactcgcttccctgcaggggaggaccaggagatccaaagggaagaacaaa
cacagcaagagggctctgcttgtgtgccagtga

DBGET integrated database retrieval system