KEGG   Macaca mulatta (rhesus monkey): 701024Help
Entry
701024            CDS       T01028                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00280  Valine, leucine and isoleucine degradation
mcc00350  Tyrosine metabolism
mcc00380  Tryptophan metabolism
mcc00750  Vitamin B6 metabolism
mcc00760  Nicotinate and nicotinamide metabolism
mcc00830  Retinol metabolism
mcc00982  Drug metabolism - cytochrome P450
mcc01100  Metabolic pathways
mcc04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    701024 (AOX1)
   00350 Tyrosine metabolism
    701024 (AOX1)
   00380 Tryptophan metabolism
    701024 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    701024 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    701024 (AOX1)
   00830 Retinol metabolism
    701024 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    701024 (AOX1)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    701024 (AOX1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     701024 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Motif
Other DBs
NCBI-GeneID: 701024
NCBI-ProteinID: NP_001268238
Ensembl: ENSMMUG00000021931
UniProt: M1ZMN0
Position
12
AA seq 1338 aa AA seqDB search
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITNRIRHHPANACLIPICSLYGTAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLHQLTDALGGNLCRCTGYRPIIDACKTFCETLGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQPQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPQVKFKGVFHPVIISPDRIEELSVVNHT
HNGLTLGAGLSLAQVKDILADVVQKLPEEKTQTYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KLEFVSAFRQAQRQENALAIVNSGMRVFFGEGHGIIRELSISYGGVGPATICAKNSCQKL
IGRHWNEEMLDTACRLVLEEVSLSGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPI
HYPSLADKYESALEDLHSKHHCSTLKYQHMGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPPVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDVITAEHLSDVNSFCFFTEAE
EFLATDKVFCVGQLVCAVLADSEVQAKQAAKQVKIVYQDLEPLILTIKEAIQHNSFFEPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVKRVGGAFGGKAFKTGVIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGNSLDESLLVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAGLITESCIMEVAAKCGLSPEKVRMINMYKEID
QTPYKQEINAKNLIQCWRECMAVSSYSLRKAAVEKFNAENYWKKKGLAMVPLKYPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELGMPISNVHLRGTSTETV
PNANVSGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDDSISLSAVG
YFRGYESDINWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGVLHTRGPDQYKIPAICDTPTEFHISLLPPSENSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARRERGLHGPLSLNSPLTPEKIRMACEDKFT
KMIPRDEPGSCVPWNVPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggacagggcgtccgaactgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gttgatcctgaaacaatgctgttgccttatctgaggaagaagcttcgactcacgggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatataac
cccatcaccaacaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtactgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcacggaacccagtgtggcttctgcacacccggg
atggtgatgtccatctacacgctgctcaggaaccacccggagcccactctgcatcagtta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtgaaactttgggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaatcaatggattgccagaattcgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagccgcaaaggaccagggtgtttggcagtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggcccctgtcatcatgggaaacacctctgtggggcctcaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccataca
cataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gacgtagtccagaagcttccagaggagaagacacagacataccatgctctcctgaagcat
ttgggaactctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaacgagcagttcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagttggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcactagcgata
gtcaattcaggaatgagagtcttttttggagaagggcatggcattattagagagttatcc
atctcatatggaggcgttggtccagccaccatctgtgccaagaattcctgccagaaactc
attggaaggcactggaatgaagaaatgctggatacagcttgcaggcttgttctggaggaa
gtctccctttcgggctcggcgccaggtggaaaggtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagatggacccaatt
cactatcctagccttgcagacaagtatgaaagtgctttagaagatcttcattccaaacat
cactgcagtacattaaagtaccagcatatgggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctgtctggtgtgaagcacgccacaggggaggccatctactgt
gatgacatgcctccggtggaccaggaacttttcttgacctttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
gtcataacagcagaacatcttagtgatgtcaactccttctgctttttcaccgaagctgag
gaatttctggcgacagataaggtgttctgtgtgggtcagcttgtctgtgccgtgcttgct
gattctgaggttcaggcaaagcaagctgctaagcaagtgaagattgtctatcaagatttg
gagccactgatcctaacaatcaaggaagctatacaacacaactccttcttcgagccagaa
aggaaactggaatatggaaatgttgatgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaagggagaggatcaagaaatggatgtctacgtgtctacacagtttcctaaatat
atacaggacattgttgcctccaccttgaagctcccagctaacaaggtcatgtgccatgta
aagcgtgttggtggagcatttggagggaaggcgttcaaaaccggagtcattgcagccgtc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
aatgatggcagaatcttggccctggacatggagcattatagcaatgcaggcaactctttg
gatgaatcattattggtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaacctccgctgccggggttgggcatgcagaaccaaccttccatccaacacggctttt
cgtgggtttggctttcctcaggcagggctgatcaccgaatcttgtatcatggaagttgca
gccaaatgtggactgtcccctgagaaggtgcgaatgataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctgatccagtgttggagagaatgt
atggccgtgtcttcctactccttgaggaaagcggctgtggaaaaattcaacgcggagaat
tactggaagaagaaaggactggccatggtccccctgaagtatcctgttggccttggctca
cgcgctgctggtcaggctgctgccttggttcacatttatcttgacggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaggaatgccaatttcgaatgtccacctgcgtggaacaagcacagaaaccgtc
cctaatgcaaatgtctctggaggttctgtggtggcagatctcaacgggttggcagtaaag
gatgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgacagcattagcctttcagctgttgga
tacttcagaggttatgagtcagacataaactgggagaaaggcgaaggccatcccttcgaa
tacttcgtttatggagctgcctgttccgaggttgaaatagactgcctgacgggggatcat
aagaacatcagaacagacattgtcatggatgttggctgcagtataaatccagccattgac
ataggccagattgaaggtgcatttattcaaggcatgggactttatacaatagaagaactg
aattattctccccagggcgttctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacacacccacagagtttcacatttctttgttgcctccctctgaaaactcaaat
actctttattcgtctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgatgcagtgagtgcagcacgacgggagagaggcctgcacggacccttg
agccttaatagtccgctgaccccggagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgagcctgggtcctgtgttccttggaatgtacccatctga

DBGET integrated database retrieval system