KEGG   Macaca mulatta (rhesus monkey): 701087Help
Entry
701087            CDS       T01028                                 

Gene name
CHP2
Definition
calcineurin-like EF hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     701087 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 196 aa AA seqDB search
MGSRSSHAAVIPDADSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQQVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgcgcagctcccacgccgcggtcattcccgacgcggacagtattcggcgagag
accggcttctcccaagctagcctgctccgcctgcaccaccggttccgggcactggacagg
aacaagaagggctacctgagccgcatggatctccagcagataggggcgctggccgtgaac
cccctgggagaccgcattatagaaagcttcttccccgatgggagccagcaagttgatttc
ccaggctttgtcagggtcctggctcattttcgccctgtagaagatgaggacacagaaacc
caagaccccaagaaacccgaacctctcaacagcagaaggaacaaacttcactatgcattt
cagctctatgacctggatcgtgatgggaagatctccaggcatgagatgctgcaggttctc
cgtctgatggtcggggtacaggtaacagaagagcagctggagaacatcgctgaccgcacg
gtgcaggaggctgatgaagatggggatggggctgtgtcctttgtggagttcaccaagtcc
ttagagaagatggacgttgagcaaaaaatgagcatcaggatcctaaagtga

DBGET integrated database retrieval system