KEGG   Macaca mulatta (rhesus monkey): 701193Help
Entry
701193            CDS       T01028                                 

Gene name
EHHADH
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00071  Fatty acid degradation
mcc00280  Valine, leucine and isoleucine degradation
mcc00310  Lysine degradation
mcc00380  Tryptophan metabolism
mcc00410  beta-Alanine metabolism
mcc00640  Propanoate metabolism
mcc00650  Butanoate metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc01212  Fatty acid metabolism
mcc03320  PPAR signaling pathway
mcc04146  Peroxisome
Module
mcc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mcc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mcc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    701193 (EHHADH)
   00650 Butanoate metabolism
    701193 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    701193 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    701193 (EHHADH)
   00310 Lysine degradation
    701193 (EHHADH)
   00380 Tryptophan metabolism
    701193 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    701193 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    701193 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    701193 (EHHADH)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     701193 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     701193 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     701193 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 Peptidase_S49 TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 701193
NCBI-ProteinID: NP_001244421
Ensembl: ENSMMUG00000005531
UniProt: F7GFA8
Position
2
AA seq 723 aa AA seqDB search
MAEYTRLHNALALIRLRNPPVNAISTAVLRDVKEGLQKAVIDHTIKAIVICGAEGKFSAG
ADIHGFSAPRTFGLTLGHVVDEIQRNVKPVVAAIQGMAFGGGLELALGCHYRIAHTEAQV
GLPEVTLGLLPGARGTQLLPRLIGVPAALDLITSGRHILAGEALKLGILDKVVNSDPVEE
AIRFAQTVSDQPLESRRLCNKPIQSLPNMDTIFSEVLLKMQKQHPGCLAQEACVRAVQAA
VQYPYEVGIKKEEELFLYLFQSGQARALQYAFFAERKANKWSTPSGASWKTASAQPVSSV
GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKIITSVLEKEASKMQQSGHPWSG
PKPKLTSSMKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSRYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQTYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLPPGTPARKRGNRRYCPIPDMLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFL
SQYRETYHIEPRTISQDEILERCLYSLINEAFHILGEGIATSPEHIDVVYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPS
SNL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtatacgcggctgcacaacgccttggcgctgatccgcctccgaaacccgccg
gtcaacgcgatcagtacggccgtactccgtgatgtaaaagaaggactacagaaagctgta
atagaccatacaataaaagccattgtgatttgtggagcagagggcaaattttctgcaggt
gctgatattcatggcttcagtgctcctaggacatttggcttaacactgggacatgtagta
gatgaaatacagagaaatgtgaagcctgtggtggcagcaatccaaggcatggcttttgga
gggggactagagctggccctgggctgtcactataggattgcccatacagaggcccaagtt
ggcttaccagaagttacactgggacttctccctggtgcaagaggaacccagcttctcccc
agactcattggagttcctgctgcacttgacttaattacctcaggaagacatattttagca
ggtgaagcactcaagctgggcattctagataaagttgtgaactcagacccggttgaagaa
gcaatcagatttgctcagacagtttcagatcaaccgctagaatcccgtagactctgcaac
aagccaattcagagcttgcccaacatggacaccatttttagtgaggtcctcttgaagatg
cagaagcagcaccctgggtgtcttgctcaggaggcttgtgtccgtgcagtccaggctgct
gtgcagtatccctatgaagtgggcatcaagaaggaggaggagctgtttctatatcttttt
caatcagggcaggctagagccctgcaatatgctttctttgctgaaaggaaagcaaataag
tggtcaactccctctggagcatcgtggaaaacagcatcagcacagcctgtctcctcagtt
ggtgttgttggcttgggaacaatgggccgaggcattgtcatttcttttgcaagggccaga
attcctgtgattgctgtagattcagacaaaaaccagctagcaactgcaaacaagataata
acctctgtcttggaaaaagaagcctccaaaatgcaacagagtggccacccttggtcagga
ccaaaacccaagttaacttcatctatgaaggagcttggtggtgtggatttagtcattgaa
gcagtatttgaggaaatgagcctgaagaagcaggtctttgctgaactctcagccgtgtgc
aaaccagaagcatttttgtgcactaatacttcagccctggatgttgatgagattgcttct
tccactgatcgtcctcacttggtcattggcacccacttcttttcgccagctcatgtcatg
aagttgttagaggttattcccagccgatactcttcccccactaccattgccactgttatg
aacttatcaaaaaagattaaaaagattggagtcgttgtaggcaactgttttggatttgtg
gggaatcgaatgttgaatccttattacaatcagacatatttcttgttagaagaaggcagc
aaaccagaggaggtagatcaggtgctggaagagtttggttttaaaatgggaccttttaga
gtgtccgatcttgctgggttggatgtgggctggaaatctagaaaggggcaaggtcttact
ggacctacattgcctccaggaactcctgcccgaaaaaggggcaataggagatactgccca
attcctgatatgctctgtgaattaggacgatttggccagaagacaggtaagggttggtat
caatatgacaagccattgggtaggattcacaaacccgatccctggctttccaaattccta
tcacagtatagagaaacctatcacattgaaccacgtaccattagccaggatgagatcctt
gagcgctgcttatattcacttatcaatgaagcattccatatcttgggagaagggatagct
actagcccagagcacattgatgttgtctatttacatggatatggatggccaaggcacaag
ggcggacccatgttctatgcttccacagttgggttgcccacagttctagagaagttgcag
aaatattacaggcagaaccctgatattccccaactggagcccagtgactatctaaaaaaa
ctggcttctcagggaaaccctcccctgaaagaatggcaaagcttggcaggctcccctagc
agtaacttgtga

DBGET integrated database retrieval system