KEGG   Macaca mulatta (rhesus monkey): 701245Help
Entry
701245            CDS       T01028                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mcc04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mcc04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mcc05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:mcc05030]
Human Diseases; Substance dependence; Alcoholism [PATH:mcc05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 329 aa AA seqDB search
MCGATSILHVRTRLILLTTQNAEFLQKGLQVHTCFGVYPHPSVRHDCASQKKGCAVYLRV
SVEFNKLIPENGFIKFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVR
THGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSS
QVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVD
MSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRAL
TMDSKKRIGWRFIRIDTSCVCTLTIKRGR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggagccaccagtattctccatgtgcgtacaaggttaatccttcttactactcag
aatgctgagtttctacagaaagggttgcaggtccacacatgttttggtgtctacccacac
ccttctgtacggcatgactgtgcatcccagaagaagggctgtgctgtgtacctccgcgtt
tcagtggaatttaacaaactgatccctgaaaatggtttcataaagttccaccaggtgaga
agagtgatgaccatccttttccttactatggttatttcatactttggttgcatgaaggct
gcccccatgaaagaagcaaacatccgaggacaaggtggcttggcctacccaggtgtgcgg
acccatgggactctggagagcgtgaatgggcccaaggcaggttcaagaggcctgacatca
ttggctgacacttttgaacacgtgatagaagagctgttggatgaggaccagaaagttcgg
cccaatgaagaaaacaataaggacgcagacttgtacacgtccagggtgatgctcagtagt
caagtgcctttggagcctcctcttctctttctgctggaggaatacaaaaattacctggat
gctgcaaacatgtccatgagggtccggcgccactctgaccctgcccgccgaggggagctg
agcgtgtgtgacagtattagcgagtgggtaacggcggcagacaaaaagactgcagtggac
atgtcgggcgggacggtcacagtccttgaaaaggtccctgtatcgaaaggccaactgaag
caatacttctacgagaccaagtgcaatcccatgggttacacaaaagaaggctgcaggggc
atagacaaaaggcattggaactcccagtgccgaactacccagtcgtatgtgcgggccctt
accatggatagcaaaaagagaattggctggcgattcataaggatagacacttcttgtgta
tgtacattgaccattaaaaggggaagatag

DBGET integrated database retrieval system