KEGG   Macaca mulatta (rhesus monkey): 701245Help
Entry
701245            CDS       T01028                                 

Gene name
BDNF
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  
brain-derived neurotrophic factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    701245 (BDNF)
   04024 cAMP signaling pathway
    701245 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    701245 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    701245 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    701245 (BDNF)
   05034 Alcoholism
    701245 (BDNF)
Cytokines [BR:mcc04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    701245 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
14
AA seq 304 aa AA seqDB search
MRHLNAAATAAVGPAGSSTATRTRAGRWSQNRNHDVTPPPGTRELCVDPEFHQVRRVMTI
LFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTF
EHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMS
MRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYE
TKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTI
KRGR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagacacttgaatgcagctgccaccgctgctgtggggccggcggggagcagcaccgcg
acgaggacccgggctgggcgctggagccagaatcggaaccacgatgtgactccgccgccg
gggacccgtgagctttgtgtggaccccgagttccaccaggtgagaagagtgatgaccatc
cttttccttactatggttatttcatactttggttgcatgaaggctgcccccatgaaagaa
gcaaacatccgaggacaaggtggcttggcctacccaggtgtgcggacccatgggactctg
gagagcgtgaatgggcccaaggcaggttcaagaggcctgacatcattggctgacactttt
gaacacgtgatagaagagctgttggatgaggaccagaaagttcggcccaatgaagaaaac
aataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtgcctttggag
cctcctcttctctttctgctggaggaatacaaaaattacctggatgctgcaaacatgtcc
atgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtgtgtgacagt
attagcgagtgggtaacggcggcagacaaaaagactgcagtggacatgtcgggcgggacg
gtcacagtccttgaaaaggtccctgtatcgaaaggccaactgaagcaatacttctacgag
accaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagacaaaaggcat
tggaactcccagtgccgaactacccagtcgtatgtgcgggcccttaccatggatagcaaa
aagagaattggctggcgattcataaggatagacacttcttgtgtatgtacattgaccatt
aaaaggggaagatag

DBGET integrated database retrieval system