KEGG   Macaca mulatta (rhesus monkey): 701246Help
Entry
701246            CDS       T01028                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  
cytochrome c
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Apoptosis - multiple species
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    701246
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    701246
   04215 Apoptosis - multiple species
    701246
   04115 p53 signaling pathway
    701246
 Human Diseases
  Cancers
   05200 Pathways in cancer
    701246
   05210 Colorectal cancer
    701246
   05222 Small cell lung cancer
    701246
  Neurodegenerative diseases
   05010 Alzheimer's disease
    701246
   05012 Parkinson's disease
    701246
   05014 Amyotrophic lateral sclerosis (ALS)
    701246
   05016 Huntington's disease
    701246
  Cardiovascular diseases
   05416 Viral myocarditis
    701246
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    701246
  Infectious diseases
   05134 Legionellosis
    701246
   05152 Tuberculosis
    701246
   05164 Influenza A
    701246
   05161 Hepatitis B
    701246
   05168 Herpes simplex infection
    701246
   05145 Toxoplasmosis
    701246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
14
AA seq 128 aa AA seqDB search
MRQWGRPASEQESSLRQRLKRELNMGDVEKGKKIFIMKCSQCHTVEKGGKHKTEPNLHGL
FGRKTGQARGYSYTAASKNKGITWGEDTLMKYLENPKKYIPGTKMIFVGIKKEERADLIA
YLKKATNE
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagacagtggggacgtcctgcttcggagcaggaatcttcgttgcgccagcgactaaaa
agagaattaaatatgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcc
cagtgccacactgttgaaaagggaggcaagcacaagactgagccaaatctccatggtctc
tttgggaggaagacaggtcaggcccgtggatactcttacacagccgccagtaagaacaaa
ggcatcacctggggagaggatacactgatgaaatatttggagaatcccaagaagtacatc
cctggaacaaaaatgatctttgtcggcattaagaaggaagaaagggcagacttgatagct
tatctcaaaaaagctactaatgagtaa

DBGET integrated database retrieval system