KEGG   Macaca mulatta (rhesus monkey): 701426Help
Entry
701426            CDS       T01028                                 

Gene name
JOSD1, Josephin-1
Definition
Josephin domain containing 1 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRTDV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgccatggaaaggagacaaggccaaatctgaatcattggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggagctttgtgccctccacgcc
ctcaataacgtcttccaggacagcaatgccttcacccgggatacgctgcaagagattttc
cagaggttgtctccaaacaccatggtgacacctcacaagaagagcatgctgggaaatggc
aactacgatgtgaatgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgtcggtgtcattgccctcactaatgtcatgggcttcatcatg
aatctgccctccagcctatgctggggtccactgaaactgcccctcaaaaggcagcactgg
atctgtgtccgagaggtgggaggggcctactacaacctcgactccaaactcaagatgccg
gagtggattggaggcgagagcgagctcaggaagtttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtagaggctcatcagagttggaggact
gacgtgtag

DBGET integrated database retrieval system