KEGG   Macaca mulatta (rhesus monkey): 701502Help
Entry
701502            CDS       T01028                                 

Gene name
AOX1
Definition
aldehyde oxidase 1
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mcc00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mcc00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mcc00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mcc00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mcc00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mcc00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mcc00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 1334 aa AA seqDB search
MPSLPHSDELIFFVNGRKVIERNADPEVNLLFYVRKRLRLTGTKYSCGGGGCGACTVMVS
RYNSTTKAIHHYPATVCLVPICSLYGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPAPEQITKALGGNLCHCTGYQPIVESGKTFCVESTVCELKGSG
KCCMDQEDGSLVNRWEKMCTKLYDEDEFQPLDPSQEPIFPPELIRMAEDPNKRRLTFQGE
RTTWITPATLNDLLELKANFPKAPLVMGNTELGPRIKFKNEFHPVFISPLGLPELHFVNT
TDDGVTIGAGYSLAQLNDTLHFIVSEQPKEKTKTYRALLKHLRTLAGAQIRNMATLGGHV
VSRPNFSDLNPILAAGNAAINLISKEGQRQIPLNGPFLERSPEADLKSEEIVSSVYIPYS
TQWHFVFGLRMAQRQENAFAIVNAGMSVKFEDGTNTIKNFKCSMKRGPHHCLCKPNCKQL
IGRQWDDQMLSDACRWVLDEIYIPPAAEGGMVEYRRTLIISLLFKFYLKVRRGLNQMDPQ
KFPDIPEKFMSALEDFPIETPQGIQMFQCVDPHQPPQDPVGHPVMHQSAIKHTTGEAVYI
DDMPCIDQELFLAPITSTRAHAKIISIDISEALALPGVVDVITAEDVPGDNNYQGEIFYA
QNEIICVGQIVGTVAADTYAHAREAAKKVKIAYEDIEPRIITIEQALKHNSFLFDEKKIE
QGNVEQAFKYVDQIIEGEVHVEGQEHFYMETSSILALPKEEDKEMVLHLGTQYPTRVQEY
VAAALNVPRNRITCRMKRTGGAFGGKVAKPAVLGAVSAVAANKTGRPIRFILERGDDMLI
TAGRHPLLGKYKIGFMNNGVIKPADVEYYVNGGCTPDESEMVVEFIVLKSENAYYIPNFR
CRGRACKTNLPSNTAFRGFGFPQGTVVVEAYITAVASQCNLPPEEVKEINMYKRISKTAF
KQTFNPEPLRRCWKECLEKSSFYTRKLAAEEFNKKNYWKKRGLAIVPMKFCIGIPTAYYN
QAAALVHIYLDGSVLVTHGGCELGQGLYTKMIQGASHELNIPQSYIHLSETSTVTVPNGV
FTSGSMGTDINGKAVQNACQALMARLHPIIRKNPKGKWEDWIAKAFEKSISLSATGYFKG
YQTNMDWEKGEGNAYPYYVYGAACSEVEVDCLTGAHKLLRTDIFMDAAFSINPALDIGQV
EGAFIQGMGFYTIEELKYSPEGVLYSRSPDDYKIPTVTEIPEEFYVTLVRSQNPIAIYSS
KGLGEAGMFLGSSVLFAIYDAVAAARRERGLAKTFVLSSPATPEMIRMTCVDQFTDMIPR
DDPSTFTPWSIRVS
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccttccccattctgatgagctgatttttttcgtgaacggaaggaaggtgata
gagaggaatgctgatcctgaagtaaatctactgttctacgtgaggaaaagacttcgtctt
acaggcactaaatattcctgtggaggaggaggctgcggtgcctgtacagtaatggtgtca
agatacaactccacgaccaaggcgatccaccattatccagcaacggtgtgcctggtaccc
atctgttctctgtatggggctgcagtcaccaccgtggaaggtgtgggaagcatcaaaacc
aggattcaccctgtgcaggaaagacttgccaagtgtcatggcacgcagtgtggattctgc
agcccagggatggtgatgtccatctacacactgctgaggaatcacccggagccagcccct
gagcagatcaccaaagctctgggaggtaatttgtgccactgcactggataccaaccaatt
gtagaaagtggaaaaactttctgtgtggaatcaactgtttgtgaactgaaaggatcagga
aaatgttgcatggatcaagaagatgggtctttggtgaatagatgggaaaaaatgtgcacc
aaactgtacgatgaagacgaattccagcccttggatccatcccaggagcctatcttccct
cctgaactcataagaatggcagaagatccaaacaagagaaggctaaccttccaaggggag
agaaccacatggatcacccctgcaaccctgaacgaccttctggagctgaaagccaatttc
cccaaagccccgcttgtcatgggaaacacagaattgggacccaggattaaattcaaaaat
gaattccatccagtttttatatctccacttgggcttccagaactacattttgtgaacacc
acagatgatggggtgacaatcggtgcgggatacagtctagcccagttgaatgatacctta
cattttatcgtttcggagcaaccgaaggagaagactaagacctatcgagctctgctgaag
catctgaggacacttgcaggagcccagattaggaatatggccactttaggaggacatgtg
gtgagccggcctaatttttctgacctaaaccccattttagcagcaggaaatgctgccatc
aatctgatatctaaagaaggacaacggcagattcctttaaatggtcctttccttgagaga
tcacctgaggcggacttgaaatcagaagagattgtgtcatctgtttatattccctactcc
actcagtggcactttgtgtttgggctccggatggcccagcgtcaagagaacgcatttgcc
attgtcaatgctgggatgagcgtgaagtttgaagacggcacgaacacaatcaagaacttc
aaatgttctatgaagcgtgggccccaccactgtctctgcaagccaaactgcaagcagctc
attgggaggcaatgggatgaccaaatgctgagtgatgcctgccgatgggtcctggatgag
atctacatcccaccagcagctgagggtggcatggtggagtacaggcgaaccctcatcatc
agcctcctcttcaaattctacctgaaagtgaggcgaggactgaatcaaatggatccccag
aagtttcccgacattccagaaaagttcatgagtgctctagaagactttcccatagaaaca
ccccaaggaattcagatgtttcagtgtgtggatccccaccaacccccacaagatccagtt
ggacacccagtcatgcaccagtcggccattaaacacaccacaggggaagctgtgtatatt
gacgacatgccctgcatcgaccaagaactcttcctggctccaatcaccagcaccagagct
catgcaaagatcatatcaattgatatttcagaagccctggcacttccaggtgttgttgac
gtgataacagcagaggatgttccaggagataataactatcaaggagagattttctatgca
cagaatgagataatttgcgtgggtcagatcgtcggcactgtggccgctgatacctatgct
catgcaagagaggcagccaaaaaagtgaagatcgcttatgaagacatagagccaaggatt
atcacaatagagcaagccctaaagcacaattcatttctttttgatgagaaaaaaatcgag
caaggaaatgtagagcaagcctttaaatatgttgaccaaatcattgaaggtgaagtccat
gtggaaggacaggaacatttttatatggaaacatcgtctatcctggctctcccaaaagaa
gaagataaagaaatggtgttacaccttggaacacagtatccaacccgcgtgcaggaatat
gtggctgcagcactgaacgtcccaaggaatagaatcacctgccgcatgaaaagaactgga
ggagcgtttggagggaaagtggccaaacctgctgtgctaggagctgtcagtgctgtggcc
gccaacaagactggccgtccaatccggtttatcctagaacgtggtgatgacatgctgata
actgctggccgccacccgctccttggaaaatacaaaattggattcatgaacaatggtgtg
ataaaacctgctgatgtcgaatactacgtcaatggcgggtgcactcctgatgagtctgag
atggtggtggagttcattgtgctgaaatctgaaaatgcatactatattcctaatttccgg
tgccggggtagggcttgcaaaacaaatttgccatccaacacagcctttcgaggatttggc
tttcctcagggtacggtggtagtcgaagcttacataactgccgtggcatctcaatgcaac
ttaccccctgaagaggttaaagaaataaacatgtataagagaattagcaaaacagccttt
aagcagacatttaatccagagccattgcgaagatgctggaaagaatgtctggagaaatct
tcattctatactaggaaactggccgcagaggaatttaacaaaaagaattactggaagaag
aggggacttgccatagtgcccatgaaattttgcattgggatccccacagcttactacaat
caggcggcagctctcgttcacatctatctagatggctctgtcttggtgactcatggtggc
tgtgaactgggacaaggcctatataccaaaatgattcagggggctagtcacgaactcaat
atcccccagtcatacatacacctgtctgaaacaagcacagtcacagtgcccaatggcgtc
ttcacgtcgggatcaatggggacagacatcaatggaaaggctgtgcagaatgcctgccaa
gctcttatggcccgtcttcatcccatcatcaggaaaaaccctaaaggaaaatgggaggat
tggattgcaaaagcctttgaaaaatccatcagtctctcagctactggatatttcaaaggc
taccagacaaatatggactgggagaagggggagggtaatgcttacccgtattatgtttat
ggagcagcctgttctgaggttgaagtcgactgtctcacgggggctcataagcttcttagg
accgacatcttcatggatgccgctttcagcataaacccagccctggatattggacaggtt
gagggagcatttattcaaggcatgggattctataccatagaagaactgaaatactcccca
gaaggtgtgctttattctcggagtccagatgactacaaaatccccaccgtcactgagata
ccagaagagttctatgtcactttggtgcgttcccaaaatcccatagccatctactcatcc
aaggggttgggtgaggctggaatgttcttggggtcctccgtgttgtttgccatatatgac
gcagtggctgctgcccgcagagagaggggcctagccaagaccttcgtcctgagtagcccg
gcaacccctgagatgattcggatgacttgtgtggatcagttcaccgacatgattcccaga
gatgacccttcaacatttacaccttggtccatccgtgtgtcttaa

DBGET integrated database retrieval system