KEGG   Macaca mulatta (rhesus monkey): 701502Help
Entry
701502            CDS       T01028                                 

Gene name
AOX4
Definition
(RefSeq) aldehyde oxidase 4 (EC:1.2.3.1)
  KO
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    701502 (AOX4)
   00350 Tyrosine metabolism
    701502 (AOX4)
   00380 Tryptophan metabolism
    701502 (AOX4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    701502 (AOX4)
   00760 Nicotinate and nicotinamide metabolism
    701502 (AOX4)
   00830 Retinol metabolism
    701502 (AOX4)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    701502 (AOX4)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    701502 (AOX4)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     701502 (AOX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 1332 aa AA seqDB search
MPSLPHSDELIFFVNGRKVIERNADPEVNLLFYVRKRLRLTGTKYSCGGGGCGACTVMVS
RYNSTTKAIHHYPATVCLVPICSLYGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPAPEQITKALGGNLCHCTGYQPIVESGKTFCESTVCELKGSGK
CCMDQEDGSLVNRWEKMCTKLYDEDEFQPLDPSQEPIFPPELIRMAEDPNKRRLTFQGER
TTWITPATLNDLLELKANFPKAPLVMGNTELGPRIKFKNEFHPVFISPLGLPELHFVNTT
DDGVTIGAGYSLAQLNDTLHFIVSEQPKEKTKTYRALLKHLRTLAGAQIRNMATLGGHVV
SRPNFSDLNPILAAGNAAINLISKGQRQIPLNGPFLERSPEADLKSEEIVSSVYIPYSTQ
WHFVFGLRMAQRQENAFAIVNAGMSVKFEDGTNTIKNFKCSMKRGPHHCLCKPNCKQLIG
RQWDDQMLSDACRWVLDEIYIPPAAEGGMVEYRRTLIISLLFKFYLKVRRGLNQMDPQKF
PDIPEKFMSALEDFPIETPQGIQMFQCVDPHQPPQDPVGHPVMHQSAIKHTTGEAVYIDD
MPCIDQELFLAPITSTRAHAKIISIDISEALALPGVVDVITAEDVPGDNNYQGEIFYAQN
EIICVGQIVGTVAADTYAHAREAAKKVKIAYEDIEPRIITIEQALKHNSFLFDEKKIEQG
NVEQAFKYVDQIIEGEVHVEGQEHFYMETSSILALPKEEDKEMVLHLGTQYPTRVQEYVA
AALNVPRNRITCRMKRTGGAFGGKVAKPAVLGAVSAVAANKTGRPIRFILERGDDMLITA
GRHPLLGKYKIGFMNNGVIKPADVEYYVNGGCTPDESEMVVEFIVLKSENAYYIPNFRCR
GRACKTNLPSNTAFRGFGFPQGTVVVEAYITAVASQCNLPPEEVKEINMYKRISKTAFKQ
TFNPEPLRRCWKECLEKSSFYTRKLAAEEFNKKNYWKKRGLAIVPMKFCIGIPTAYYNQA
AALVHIYLDGSVLVTHGGCELGQGLYTKMIQGASHELNIPQSYIHLSETSTVTVPNGVFT
SGSMGTDINGKAVQNACQALMARLHPIIRKNPKGKWEDWIAKAFEKSISLSATGYFKGYQ
TNMDWEKGEGNAYPYYVYGAACSEVEVDCLTGAHKLLRTDIFMDAAFSINPALDIGQVEG
AFIQGMGFYTIEELKYSPEGVLYSRSPDDYKIPTVTEIPEEFYVTLVRSQNPIAIYSSKG
LGEAGMFLGSSVLFAIYDAVAAARRERGLAKTFVLSSPATPEMIRMTCVDQFTDMIPRDD
PSTFTPWSIRVS
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccttccccattctgatgagctgatttttttcgtgaacggaaggaaggtgata
gagaggaatgctgatcctgaagtaaatctactgttctacgtgaggaaaagacttcgtctt
acaggcactaaatattcctgtggaggaggaggctgcggtgcctgtacagtaatggtgtca
agatacaactccacgaccaaggcgatccaccattatccagcaacggtgtgcctggtaccc
atctgttctctgtatggggctgcagtcaccaccgtggaaggtgtgggaagcatcaaaacc
aggattcaccctgtgcaggaaagacttgccaagtgtcatggcacgcagtgtggattctgc
agcccagggatggtgatgtccatctacacactgctgaggaatcacccggagccagcccct
gagcagatcaccaaagctctgggaggtaatttgtgccactgcactggataccaaccaatt
gtagaaagtggaaaaactttctgtgaatcaactgtttgtgaactgaaaggatcaggaaaa
tgttgcatggatcaagaagatgggtctttggtgaatagatgggaaaaaatgtgcaccaaa
ctgtacgatgaagacgaattccagcccttggatccatcccaggagcctatcttccctcct
gaactcataagaatggcagaagatccaaacaagagaaggctaaccttccaaggggagaga
accacatggatcacccctgcaaccctgaacgaccttctggagctgaaagccaatttcccc
aaagccccgcttgtcatgggaaacacagaattgggacccaggattaaattcaaaaatgaa
ttccatccagtttttatatctccacttgggcttccagaactacattttgtgaacaccaca
gatgatggggtgacaatcggtgcgggatacagtctagcccagttgaatgataccttacat
tttatcgtttcggagcaaccgaaggagaagactaagacctatcgagctctgctgaagcat
ctgaggacacttgcaggagcccagattaggaatatggccactttaggaggacatgtggtg
agccggcctaatttttctgacctaaaccccattttagcagcaggaaatgctgccatcaat
ctgatatctaaaggacaacggcagattcctttaaatggtcctttccttgagagatcacct
gaggcggacttgaaatcagaagagattgtgtcatctgtttatattccctactccactcag
tggcactttgtgtttgggctccggatggcccagcgtcaagagaacgcatttgccattgtc
aatgctgggatgagcgtgaagtttgaagacggcacgaacacaatcaagaacttcaaatgt
tctatgaagcgtgggccccaccactgtctctgcaagccaaactgcaagcagctcattggg
aggcaatgggatgaccaaatgctgagtgatgcctgccgatgggtcctggatgagatctac
atcccaccagcagctgagggtggcatggtggagtacaggcgaaccctcatcatcagcctc
ctcttcaaattctacctgaaagtgaggcgaggactgaatcaaatggatccccagaagttt
cccgacattccagaaaagttcatgagtgctctagaagactttcccatagaaacaccccaa
ggaattcagatgtttcagtgtgtggatccccaccaacccccacaagatccagttggacac
ccagtcatgcaccagtcggccattaaacacaccacaggggaagctgtgtatattgacgac
atgccctgcatcgaccaagaactcttcctggctccaatcaccagcaccagagctcatgca
aagatcatatcaattgatatttcagaagccctggcacttccaggtgttgttgacgtgata
acagcagaggatgttccaggagataataactatcaaggagagattttctatgcacagaat
gagataatttgcgtgggtcagatcgtcggcactgtggccgctgatacctatgctcatgca
agagaggcagccaaaaaagtgaagatcgcttatgaagacatagagccaaggattatcaca
atagagcaagccctaaagcacaattcatttctttttgatgagaaaaaaatcgagcaagga
aatgtagagcaagcctttaaatatgttgaccaaatcattgaaggtgaagtccatgtggaa
ggacaggaacatttttatatggaaacatcgtctatcctggctctcccaaaagaagaagat
aaagaaatggtgttacaccttggaacacagtatccaacccgcgtgcaggaatatgtggct
gcagcactgaacgtcccaaggaatagaatcacctgccgcatgaaaagaactggaggagcg
tttggagggaaagtggccaaacctgctgtgctaggagctgtcagtgctgtggccgccaac
aagactggccgtccaatccggtttatcctagaacgtggtgatgacatgctgataactgct
ggccgccacccgctccttggaaaatacaaaattggattcatgaacaatggtgtgataaaa
cctgctgatgtcgaatactacgtcaatggcgggtgcactcctgatgagtctgagatggtg
gtggagttcattgtgctgaaatctgaaaatgcatactatattcctaatttccggtgccgg
ggtagggcttgcaaaacaaatttgccatccaacacagcctttcgaggatttggctttcct
cagggtacggtggtagtcgaagcttacataactgccgtggcatctcaatgcaacttaccc
cctgaagaggttaaagaaataaacatgtataagagaattagcaaaacagcctttaagcag
acatttaatccagagccattgcgaagatgctggaaagaatgtctggagaaatcttcattc
tatactaggaaactggccgcagaggaatttaacaaaaagaattactggaagaagagggga
cttgccatagtgcccatgaaattttgcattgggatccccacagcttactacaatcaggcg
gcagctctcgttcacatctatctagatggctctgtcttggtgactcatggtggctgtgaa
ctgggacaaggcctatataccaaaatgattcagggggctagtcacgaactcaatatcccc
cagtcatacatacacctgtctgaaacaagcacagtcacagtgcccaatggcgtcttcacg
tcgggatcaatggggacagacatcaatggaaaggctgtgcagaatgcctgccaagctctt
atggcccgtcttcatcccatcatcaggaaaaaccctaaaggaaaatgggaggattggatt
gcaaaagcctttgaaaaatccatcagtctctcagctactggatatttcaaaggctaccag
acaaatatggactgggagaagggggagggtaatgcttacccgtattatgtttatggagca
gcctgttctgaggttgaagtcgactgtctcacgggggctcataagcttcttaggaccgac
atcttcatggatgccgctttcagcataaacccagccctggatattggacaggttgaggga
gcatttattcaaggcatgggattctataccatagaagaactgaaatactccccagaaggt
gtgctttattctcggagtccagatgactacaaaatccccaccgtcactgagataccagaa
gagttctatgtcactttggtgcgttcccaaaatcccatagccatctactcatccaagggg
ttgggtgaggctggaatgttcttggggtcctccgtgttgtttgccatatatgacgcagtg
gctgctgcccgcagagagaggggcctagccaagaccttcgtcctgagtagcccggcaacc
cctgagatgattcggatgacttgtgtggatcagttcaccgacatgattcccagagatgac
ccttcaacatttacaccttggtccatccgtgtgtcttaa

DBGET integrated database retrieval system