KEGG   Macaca mulatta (rhesus monkey): 701579Help
Entry
701579            CDS       T01028                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L1-like
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    701579
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     701579
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   701579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 219 aa AA seqDB search
MQLKPMEINPEVLSRLGVAGQWRFVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFRK
KQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKM
SPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVN
HGASSEGTLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaagccgatggagatcaaccccgaggtgctgtcccggctgggggtcgccggc
cagtggcgcttcgtggacgtgctggggctggaagaggagtctctgggctcggtgccagcg
cctgcctgcgcgctgctgctgctgtttccactcacggcacagcatgagaacttcaggaaa
aaacagattgaagagctgaagggacaagaagttagtcctaaagtgtacttcatgaagcag
accattgggaattcctgtggcacaatcggacttatacacgcagtggccaataatcaagat
aaactgggatttgaggatggatcagtcctgaaacagtttctttctgaaacagagaaaatg
tcccctgaagacagagcaaaatgctttgaaaagaatgaggccatacaggcagcccatgat
gccgtggcacaggaaggccaatgtcgggtagatgacaaggtgaatttccatttcattctg
tttaacaacgtggatggccacctctatgaactggatggacgaatgccttttccggtgaac
catggcgccagttcagagggcaccctgctgcaggacgctgccaaggtctgcagagaattc
accgagcgtgagcaaggagaagtccgcttctctgccgtggctctctgcaaggcagcctaa

DBGET integrated database retrieval system