KEGG   Macaca mulatta (rhesus monkey): 701660Help
Entry
701660            CDS       T01028                                 

Gene name
USP47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     701660 (USP47)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   701660 (USP47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 1287 aa AA seqDB search
MVPGEENQLVPKEAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLEDSSAGEDS
VHDRFIGPLPREGSVGSTSDYVSQSYSYSSILNKSKTGYVGLVNQAMTCYLNSLLQTLFM
TPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAW
QQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIP
LVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTL
QLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAENEGSCHSD
QMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHYYACI
KSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLKDPAR
NAKFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQVMMENKLEV
HKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVK
STYMFDLLLETRKPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQL
ISKAIHLPAETMRIVLERCYNDLRLLSVSSKTLKAEGFFRSNKVFVESSETLDYQMAFAE
SHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVDDDCERVKGPVGSLKS
VEAILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERDSSASVDNRELEQ
HIQTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIPLANGLDSH
SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYAADEGSGEG
HKWLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNETLSSFSDDN
KITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCG
LELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVL
SRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLEDIEFAKGRGTFPCDISVLDI
HQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGH
RVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggcgaggagaaccaactggtcccgaaagaggcgccactggatcataccagt
gacaagtcacttcttgacgctaattttgagccaggaaagaagaactttctgcatttgaca
gataaagatggtgaacaacctcaaatactgctggaggattccagtgctggggaagacagt
gttcatgacaggtttataggtccgcttccaagagaaggttctgtgggttctaccagtgat
tatgtcagccaaagctactcctactcatctattttgaataaatcaaaaactggatatgtg
ggactagtaaaccaagcaatgacttgctatttgaatagccttttgcaaacactttttatg
actcctgaatttaggaatgcattatataagtgggaatttgaagaatctgaagaagatcca
gtgacaagtattccataccaacttcaaaggctttttgttttgttacaaaccagcaaaaag
agagcaattgaaaccacagatgttacaaggagctttggatgggatagtagtgaggcttgg
cagcagcatgatgtacaagaactatgcagagtcatgtttgatgctttggaacagaaatgg
aagcaaacagaacaggctgatcttataaatgaactatatcaaggcaagctgaaggactac
gtgagatgtctggaatgtggttatgagggttggcgaatcgacacatatcttgatattccg
ttggtcatccgaccttatgggtccagccaagcatttgctagtgtggaagaagcattacat
gcatttattcagccagagattttggatggcccaaatcaatatttttgtgaacgttgtaag
aagaagtgtgatgcacggaagggccttcggtttttgcattttccttatctgctgacctta
cagctgaaaagatttgattttgattatacaaccatgcataggattaaactgaatgatcga
atgacatttcccgaggaactagatatgagtacatttattgatgttgaagatgagaaatct
cctcagactgaaagttgcactgacagtggagcagaaaatgaaggtagttgtcacagcgat
cagatgagcaatgatttctccaatgatgatggtgttgatgaaggaatctgccttgaaacc
aatagtggaaccgaaaagatctcaaaatctggacttgaaaagaattccttgatctatgaa
ctcttctctgttatggttcattccgggagtgctgctggtggtcattattatgcatgtata
aagtcattcagtgatgagcagtggtacagcttcaatgatcaacatgtcagcaggataaca
caagaggacattaagaaaacacatggcggatcttcaggaagcagaggatattattccagt
gctttcgcaagttccacaaatgcatatatgctgatctatagactaaaggatccagccaga
aatgcaaaatttctagaagtggatgaatacccagaacatattaaaaacttggtgcagaaa
gagagagagttggaagaacaagaaaagagacaacgagaaattgagcgcaatacatgcaag
ataaaattattctgtttgcatcctacaaaacaagtaatgatggaaaataaattggaggtt
cataaggataagacattaaaggaagcagtagaaatggcttataagatgatggatttagaa
gaggtaatacccctggattgctgtcgccttgttaaatatgatgagtttcatgattatcta
gaacggtcatatgaaggagaagaagatacaccaatggggcttctactaggtggcgtcaag
tcaacatatatgtttgatttgctgctggagacgagaaagcctgatcaggttttccagtct
tataaacctggagaagtgatggtgaaagttcatgttgttgacctaaaggcagaatctgta
gctgctcctataactgttcgtgcttacttaaatcagacagttacagagttcaaacaactg
atttcaaaggccatccatttacctgctgaaacaatgagaatagtgctcgaacgctgctat
aatgatttgcgtcttctcagtgtctccagtaaaaccctgaaagctgaaggattttttaga
agtaacaaggtgtttgttgagagttccgagactttggattaccagatggcctttgcagag
tctcatttatggaaactcctggatcggcatgcaaatacaatcagattatttgttttgcta
cctgaacaatccccaggatcttattccaaaaggacagcataccagaaagctggaggcgat
tctggtaatgtggatgatgattgtgaaagagtcaaaggacctgtaggaagcctaaagtct
gtggaagctattctagaagaaagcactgaaaaactcaaaagcttgtcactgcagcaacag
caggatggagataatggggacagcagcaaaagtactgagacaagtgactttgaaaacatc
gaatcacctctcaatgagagggactcttcagcatcagtagataatagagaacttgaacaa
catattcagacttctgatccagaaaattttcagtccgaagaacgatcagactcagatgtg
aataatgacaggagtacaagttcagtggacagtgatattcttagctccagtcatagcagt
gatactttgtgcaatgcagacaatgctcagatccctttggctaatggacttgactctcac
agtatcacaagtagtagaagaactaaagcaaatgaagggaaaaaagaaacatgggataca
gcagaagaagactctggaactgatagtgaatatgatgagagtggcaagagtaggggagaa
atgcagtacatgtatttcaaagctgaaccctatgctgcagatgaaggttctggggaagga
cataaatggttgatggtgcatgttgataaaagaattactctggcagctttcaaacaacat
ttagagccctttgttggagttttgtcctctcacttcaaggtctttcgagtgtatgccagc
aatcaggagtttgagagcgtccggctgaatgagacactttcatcattttctgatgacaat
aagattacaattagactggggagagcacttaaaaaaggagaatacagagttaaagtgtac
cagcttttggtcaatgaacaagagccatgcaagtttctgctagatgctgtgtttgctaaa
ggaatgactgtacggcaatcaaaagaggaattaattcctcagctcagggagcaatgtggt
ttagagctcagtattgacaggtttcgtctgaggaaaaaaacgtggaagaatcctggcact
gtctttttggattatcatatttatgaagaagatattaatatttccagcaactgggaggtt
ttccttgaagttcttgatggggtagagaagatgaagtccatgtcacagcttgcagttttg
tcaagacggtggaagccttcagagatgaagttggatcccttccaggaggttgtattggaa
agcagtagtgttgacgaattgcgagagaagcttagtgaaatcagtgggattcctttggaa
gatattgaatttgctaagggtagaggaacatttccctgtgatatttctgtccttgatatt
catcaagatttagactggaatcccaaagtttctaccctgaatgtctggcctctttatatc
tgtgatgatggtgcagtcatattttatagggataaaacagaagaattaatggaattgaca
gatgagcaaagaaatgaactgatgaaaaaagaaagcagtcgactccagaagactggacat
cgtgtaacatactcacctcgtaaagagaaagcactaaaaatatatctggatggagcacca
aataaagatctgactcaagactga

DBGET integrated database retrieval system