KEGG   Macaca mulatta (rhesus monkey): 701758Help
Entry
701758            CDS       T01028                                 

Gene name
PLCE1
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    701758 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    701758 (PLCE1)
   04015 Rap1 signaling pathway
    701758 (PLCE1)
   04020 Calcium signaling pathway
    701758 (PLCE1)
   04070 Phosphatidylinositol signaling system
    701758 (PLCE1)
   04024 cAMP signaling pathway
    701758 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    701758 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    701758 (PLCE1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    701758 (PLCE1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     701758 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 2317 aa AA seqDB search
MTSEEITASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRQSGETSHTISRLNKL
KEEPSGSNLPKILSITREKIVSDENSNEKCWEKSMPDSVKNLNINCNNILRNHQHGLPQR
QFYEMYNSVVEEDLCLETGILSPLERKVFPGIQLELDRPSMGINPLGNQSAIIETGRADP
DSSTAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKENYMAYTCKLMEL
AKNCDNKNEQLQCDHCDTLNDKYFCFEGSCQKVDMVCSSHSFCKEDFTDSQTAKTFLSHF
EDFPDNCEDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLIA
WSYIDQKRNGPLLPCGRVMEPLSTVEIKQGGSRRLSEAQWYPIYNAVRRGEETENTVGSL
LHFFTKLPASETAHGRISVGPCLKQCVRDTVYEYRATLQRTSISQYITGSLLEATTSLGA
RSGLLSTFGGSTGRMMLKERQPGPSVANSNTLPSSSAGISKELIDLQPLIQFPEEVASIL
MEQEQSIYRRVLPVDYLCFLTRDLGTPECQRSLPCLKASISASILTTQNGEHNALEDLVM
RFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKM
WQFMDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDG
ASGLMKICPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCSR
SLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAF
DHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTA
SPASTKAKLGVLNNTAEPGKFPLLGNAGLSGLTEGVLDLFAVKAVYMGHPGIDIHTVCVQ
NKLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQR
QQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPSMQRNNTL
GISTTKKKKKILMRGESGEATDDEMATRKAKMHKECRSRSGSDPQDINEQEESEANTIAS
PPNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLPSSNKSPSSAWSSSSWHGRIKGG
MKGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCSRSGSESAPLYTNLM
IDENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSL
GIFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPNISMCHQGLMSFEGFARFLMDKEN
FASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELD
CWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAE
IFKTVFGEKLVAKFLFETDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQL
ASMQAQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDADVLTASPAPNGQEDNILEDR
PENKSCSDKLQFEYSEEIPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPEL
SDLVIYCQAVKFPGLSTLNASGSNRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSC
EGIRQTWEESSSPLNPTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLL
RTYPAATRIDSSNPNPIMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVL
WDKNCPMYQKFSPLERDLDSMDPVVYSLTIVSGQNVCPSNSTGSPCIEVDVLGMPLDSCH
FRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRH
LQLRNLHNEVLEISSLFVNSRRMEENSSGSPMSASSMFTTEERKCLQTHRVTVHGVPGPE
PFTVFTINGGTKAKQLLQQILTTEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIG
PEEEIVQILSSWFPEEGYVGRILLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVS
PEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKSTTP
KSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQ
PRGLTSPSQLLTSESIQTKEEKPVGGLSSSDTMDYRQ
NT seq 6954 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaattacagcttctgttctcatacctgtgactcagagaaaagtggtt
tctgcccagtcagctgcagatgaaagtagtgaaaaggtctcagacatcaatatttcaaaa
gcacatactgtcagacaaagtggggagacttctcataccatctcacgactgaacaaactt
aaagaagaaccttctggaagcaacttgccaaagattctctcaataacaagggagaaaata
gtgagtgatgagaacagtaatgaaaaatgctgggagaaaagcatgccagattctgtgaaa
aaccttaacattaactgcaacaacatattgagaaaccatcagcatggccttcctcaaaga
cagttttatgaaatgtacaactctgttgttgaggaagacctgtgtttagaaactggaatt
ctgtctccactggaaagaaaggtgttccctggaattcaactggaactagacagaccttcc
atgggcattaatcctttaggaaatcagtcagcaatcatagagacaggcagagcagaccct
gacagcagcacggcagtatttcattttcattatgaagttgacagaagaatgtcagacact
ttctgtaccctatcagaaaacttaattttagacgattgtggaaattgtgtaccactacct
gggggtgaggagaagcaaaaggaaaactacatggcatatacctgtaaactgatggaattg
gccaaaaattgtgataataagaatgaacagctgcagtgtgatcattgtgacaccttgaat
gataaatacttttgctttgaaggctcttgccagaaggtggacatggtatgttcaagtcat
agcttttgtaaggaagattttactgacagtcaaactgccaagacctttttgagtcatttt
gaggatttccctgataattgtgaagatgtagaagaagatgcttttaaaagcaaaaaggag
cggtccactttgttagtcaggagattctgtaaaaatgacagagaagttaagaaatctgtg
tataccggcacaagagcaattgtgaggactctgccttctggccacattgggctgattgca
tggagttacatagatcagaagagaaatggtcccttactgccttgtgggagagtaatggaa
cccctatcaacagtggagataaagcaaggtgggagccgacgtctgtcagaagcccagtgg
tatcctatctacaatgcagtgagaagaggagaagaaacagaaaatacagttggatctcta
ctccatttcttcaccaagctcccagcctccgagacagcccatggaagaataagtgttggt
ccatgcttaaagcaatgtgtccgagacactgtatatgagtatcgcgccaccctccaaagg
acttcaatatcgcagtacatcaccggttctctcctagaagcaaccacatctttgggagca
agaagtggccttctcagtacttttggaggatccactggacgaatgatgctgaaagaacgc
cagccaggcccctctgtggccaattccaacaccctcccttcaagttcagctgggatcagc
aaggagctgatcgatctgcagcctctcatccagttcccagaggaagtcgccagcatcctg
atggagcaggagcagagtatttaccgcagggtcttgccggtcgactacctttgcttctta
acacgggacttgggcactcccgaatgccagaggtccctgccctgcctcaaagcatccatc
tcagcgtcaattcttaccactcagaatggagagcacaatgcccttgaagatctggtgatg
aggtttaatgaggtgagctcctgggtgacgtggctgatcctcacggcaggctccatggag
gagaagcgagaagtcttttcatatttggtgcatgtggccaagtgctgctggaacatgggc
aactacaacgctgtcatggagttcttggctggcctcaggtcaagaaaagttttaaaaatg
tggcagtttatggaccagtctgatattgagaccatgaggagcctgaaggatgctatggcc
cagcatgagtcctcttgtgagtacagaaaggtggtgacacgtgccctgcacatccctggc
tgtaaggtggttccgttctgtggagtgtttcttaaggagctctgtgaagtgcttgacggc
gcctctggcctcatgaagatatgcccgcggtacaattcccaagaagaaactttagagttt
gtagcagattacagtggacaagataatttcttacaacgagtgggacaaaatggcttaaag
aattcggagaaggagtccactgtcaacagcatctttcaggtcatccggagctgcagtcga
agtctggagacagacgaggaggacagccccagtgaagggaacagctccaggaaaagttcc
ttgaaggataaaagccgatggcagtttataattggagatttgttggattcagacaatgat
atctttgagcaatccaaagaatacgactctcatggttcagaggactcacagaaggccttc
gaccatggaacggagctcatcccatggtatgtgctgtccatccaagccgatgtgcaccag
ttcctgctgcagggtgccacggtcatccactacgaccaggacacacacctctctgcccgc
tgcttcctccagcttcagcctgacaatagcaccttgacctgggtaaagcccacaactgcc
tccccagccagcactaaagcaaaacttggtgtacttaataacacagctgagcctggaaaa
ttcccactactgggcaatgctggattaagtggcctgacggaaggggtcttggatcttttt
gcagtgaaggctgtatacatgggccaccctggcattgatatacacactgtgtgtgttcag
aacaaactgggtagcatgttcctgtcagagactggtgtgacactgctctatgggcttcag
accacagacaatagattattgcacttcgtggcaccaaagcacacagctaaaatgctcttc
agcggattgttggaactcactagagctgtgagaaagatgaggaaattccctgaccaaaga
cagcagtggctgcggaaacagtacgtcagcctctatcaggaggatggacggtatgaaggc
ccaactttggctcatgctgtggagttgtttggtggcagacgatggagtgctcgaaacccc
agccccggcacatctgcaaagaatgctgagaagcccagtatgcagagaaacaacaccctg
ggcataagcactaccaagaaaaagaagaaaatcctcatgaggggtgagagtggagaggca
actgacgacgagatggcaacccgaaaggccaagatgcacaaagagtgtcgaagccggagt
ggttctgatcctcaagacattaatgaacaagaagaatcagaggcgaataccatcgctagc
ccgccaaaccccctcccttccagaagagcccactctttgaccacagctgggtcccccaac
ttggctgccgggacgtcatctcccatcaggccagtgtcctcccctgtgctgccttcttca
aacaagagcccgtccagtgcttggagcagtagtagctggcacggacggatcaaaggcggc
atgaagggatttcagagcttcatggtttcagacagcaacatgagttttgttgaatttgtt
gagctgttcaaatcgttcagtgtcaggagccgcaaggacctgaaggatctgtttgatgtc
tatgcagtgccctgcagccgatctggatccgagtcagccccgctctacaccaacttgatg
attgatgaaaacaccagcgatcttcagcctgacctagatctgttgaccagaaatgtctca
gatttggggttgttcatcaagagtaaacagcagctatcagacaaccagaggcagatatct
gatgccattgctgctgcaagcatcgtgacaaatggcactgggattgagagcacatctctg
ggcattttcggggtgggcatacttcagctcaacgatttcctcgtgaattgccaaggagaa
cactgcacttatgatgaaatcctcagcatcatccagaagtttgagcctaacatcagtatg
tgtcatcagggactaatgtcatttgaagggtttgcaaggtttctgatggataaagaaaat
tttgcctcaaaaaatgatgagtcacaggagaacattaaagaactgcagctacccctctca
tactattacatcgaatcttcgcacaatacctacctcacgggccatcagctcaaaggagaa
tcctcggtagaactctacagccaggtcctcttgcaaggctgtcgaagtgtagaattggac
tgctgggacggagacgatgggatgcccatcatttatcatggacatacactgacaaccaag
atccccttcaaggaagtggttgaagccattgatcgcagtgccttcatcaactctgacctg
ccaatcatcatatcgattgagaaccactgttcattgcctcagcaacgaaaaatggcagaa
attttcaagactgtgtttggagaaaagctggtggctaaattcttatttgagactgatttc
tcagatgatccaatgcttccttcacctgaccaactcagaaggaaagtgcttcttaaaaac
aagaaactaaaagcccatcagacgccagtggatatcttaaagcaaaaggctcatcagtta
gcatctatgcaagcgcaggcttataatggtgggaatgccaaccccccacctgccaataat
gaggaagaggaagatgaggaggacgaatatgattatgactatgaatccctttctgatgca
gatgtccttactgcctcccctgctcctaacggtcaggaagacaacattctggaagacaga
cctgaaaataaatcatgtagtgacaagcttcagtttgagtatagtgaagaaatccccaag
aggataaagaaggcagataactctgcttgcaacaaaggaaaggtttatgatatggaactg
ggagaagaattttatcttgatcagaataaaaaggaaagcagacagattgcaccagagctt
tctgaccttgtaatctattgtcaagcagtaaaatttccaggactgtcaactctaaatgca
tctggctctaacagaggaaaggaaaggaaaagcaggaagtccatttttggcaacaatccg
ggcagaatgagcccaggggagacagcatcatttaacaaaacatctggaaaaagttcctgt
gaaggcattcgacagacctgggaggaatcttcttcccctctcaacccaaccacgtccctc
agtgctatcattagaactcctaaatgttatcatatctcgtcgctgaatgaaaatgccgcc
aaacgtctgtgtcgcaggtattctcagaaactgatccagcataccgcctgtcagctgctg
agaacttaccctgctgccactcgcatcgactcctccaacccgaaccccatcatgttctgg
ctccatgggatacagctcgtggcactcaactaccagaccgatgatctccctttacattta
aatgctgcaatgtttgaggcaaatggtggttgtggttatgttttgaaacctccagttctg
tgggacaagaactgcccgatgtatcagaagttttctccactggaaagagatttggacagc
atggatcctgtagtctattctttaactattgtctctggtcagaatgtgtgccccagtaac
agcacgggaagcccgtgcattgaagtcgacgtcctgggcatgcctctggacagctgccat
ttccgcacaaagcccatccatcgaaacaccctgaaccccatgtggaacgagcagtttctg
ttccgcgttcacttcgaagatcttgtatttcttcgttttgcagttgtggaaaacaacagt
tcagcggtaactgctcagagaatcattccactgaaagctttaaaacgaggctatcgacat
cttcagctgcgaaaccttcacaatgaagtcttggagatctctagtttattcgttaacagc
agaaggatggaagaaaattcctctggcagtcccatgtcagcctcttcgatgtttactaca
gaagaaagaaaatgtttgcagactcacagagtcacggtgcatggggtcccagggccagag
ccctttactgttttcactattaatggaggcaccaaggcaaagcagcttctgcagcaaatt
ctgacaactgaacaagacatcaaacctgttaccacagactattttttgatggaagaaaaa
tattttatatctaaagaaaagaatgaatgcaggaaacaaccattccagagagccattggt
ccagaagaggagatcgtgcaaattttaagcagctggtttccagaagagggatatgtgggc
aggattctcttaaaaacccagcaggaaaacctagaagagaaaaacattgttcaagatgac
aaagaggtgatcttgagctcagaggaggagagtttctttgtccaagtgcatgatgtttct
ccagagcaacctcgaacagtcatcaaagcaccccgcgtcagcaccgcacaggatgtcatt
cagcagaccttatgcaaagccaaatattcctacagcatcctgagcaaccccaatccgagt
gactatgtgcttctggaagaggtggtgaaagacactaccaacaagaagtctaccacaccc
aagtcctctcagcgggtccttctggatcaggagtgtgtgtttcaagcccaaagcaagtgg
aaaggtgcaggaaaattcatccttaagctaaaggagcaggtgcaggcatctcgagaagac
aaaaagaaaggcatttcttttgcaagtgaactcaagaagctcaccaagtcaactaaacag
ccccgaggacttacatcaccttctcagctcttgacctcagaaagtatccaaaccaaggag
gagaaacctgtgggtggcttgtcctccagtgacacaatggattaccgacagtga

DBGET integrated database retrieval system