KEGG   Macaca mulatta (rhesus monkey): 702292Help
Entry
702292            CDS       T01028                                 

Gene name
POM121L2
Definition
(RefSeq) POM121 transmembrane nucleoporin like 2
  KO
K14316  
nuclear pore complex protein Nup121
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    702292 (POM121L2)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     702292 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 1055 aa AA seqDB search
MSETSEAKTLLEATDPASYLLMGSFLSKLGLSPSSPAQVRADLPERPTKRRPTQPLHQVH
RVQFVHRAHPAPRYRPVRRSPNLDPANPTTWLANEAWRRFPMKKSQNSTLGPLPSDWWET
YLKRTIWSLRHPRPIWSPVTIKITPPDERVSPSTSPEDVIALAEPPPSEEPSDPCSKETV
LRALRECRKGKGRLEEPLFPEGLDSKRRSPETRPSAFKPLMKNGTLTSFVPRPGPLKRSL
HSWSSDHSLTKRPSCSSMSSLASIYRGGPLSSKRNAISSSYSSSRNFSDPWKRSIPSVSF
ETPEWPIKKKKIDHRPYSSVPLVSDFESSGASGSSGQQNQKIPQLPSSPENLLSEIPLPQ
LGYAVSDEDLTLGKKTELQRSNNAREDTTEVTTDPVPETWLAIQPSLSLTPPSSETDLTQ
GANPQLQNLTKMQKSLGPLTSPQSTGEVTSVAHSPLKTPSLPTPPGCSQSELLPGTSPDS
KPTATFIVLTPTSPTSPVTDTIWLPSTFQADRSPMPPDPPAPPTIQSTLLGMVSSPTPHL
SASAPPDATSAHLMLKPILGPLHNSEIGGSSYSKISVTAAASLSSSLSTQGTLTPTFKPI
FGSIDPLKTMPMIAPFSSKQTPPPFTHASTHHFHGLVKATTVVMPTTLASTSKDSVFKPP
LDFGVVNVTGAIGNTYSVPSTCDTFLLRTAQAFRADFTPATGFIFPPHHRPTIPTVHTVT
IFTQVLSSAVQISPRSSTANFRSVGSPLPASALVSTNWPASSPSVSSLTPAITSPLGSSS
RPPFPLSQGANPQPAFGATDGQKQGPSQPALTPSVSSSFLFGSSAVALPTPVPTPAQPAF
ISTTQSALGCLIPSASTSQTPASTWPGIGSIPAGFPISQASTTGFRIVIQTHQSGAFGSV
FGSRAPRPFAFGGFVTPMDCDESGIRMTGPDMSSTSGAFSIGALPSGTTSTMIPYGKGWS
QNTQGLPSHSTAFALGRASISVRKTMAPIAQSTPVPGQAKAGSSVDFGMPFPPAQGSVGR
GPFRSSASSFSMGTKSKTSKNREQGHSRRHHAYKK
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaacctcggaagccaaaaccttgcttgaagccactgaccccgcctcatatctc
ctcatgggcagtttcctgagcaagctgggactttcgccctcgtccccagcccaggtgcgc
gccgacttgcccgagaggcccacgaaacgccggccaactcagccccttcaccaagttcat
cgggttcagttcgtccaccgcgcccaccctgccccacggtatagacctgtgaggaggtcg
ccaaacctggatcctgccaatccaaccacgtggctggccaacgaggcttggaggcgcttt
cccatgaagaagtcccagaattccaccctggggcctctcccttcagactggtgggaaact
tacttaaagcggactatttggtctcttcgacatcctaggccaatttggagcccagtgacc
atcaagatcactcctcctgatgagagggtgtccccttccacttctcctgaagatgtaatt
gcccttgcagaacccccaccctctgaggagccctcagatccctgttcaaaggagacagtg
ttgagggccctcagagagtgcagaaaagggaaagggaggttggaagaaccactattccct
gagggcttggacagtaagagaaggagtccagagaccagaccatctgcatttaagcctctg
atgaaaaatggaaccctcacttcttttgtgcccaggcctgggccgctgaagagaagtctc
cattcctggagctcggatcacagcttgactaagagacccagttgctcctccatgagctcc
ttggccagcatatacagaggtggccccctcagctccaaaaggaatgctatttccagctct
tacagctcttccagaaatttctcagacccttggaaaagaagtattcccagtgtatcattc
gagacaccagagtggccaataaaaaagaaaaaaattgatcatcggccttactcttcagtc
ccactggtatcagattttgagtcctcaggagcatctggaagttctgggcagcaaaatcaa
aagattccacagctgccgtctagccctgagaacctgctgtcggagatcccacttccccag
cttggttatgcagtctctgatgaggacttgaccttggggaagaaaactgaactacagcgg
agcaacaacgcgagagaagatacaactgaggtcaccacagaccctgtccctgagacttgg
cttgctattcagccttccctatctctcactccgccttcttcggaaacagatctaacccag
ggggcgaatcctcagttgcaaaacttaacaaaaatgcagaagtctctaggtccactgacc
tccccacagtccacgggagaggtaaccagtgtggcccattctcctttgaagacacccagc
ctaccaaccccaccagggtgctcacagtcagagctccttccaggcacctctccagactca
aagcccacagctactttcatcgtgctgacccccacctctcccacatcaccagttactgac
accatctggctgccttcaacctttcaggctgacaggtctcccatgcccccagacccacct
gcaccacccaccatccaaagtactttgcttggaatggtgagtagcccaactccccatctt
tccgcatctgcacctcctgatgcaacttctgctcacctcatgttaaaaccgattttgggg
cccctgcacaatagcgagattggaggctcctcatattccaaaatttcagtcacagctgca
gcgtctttaagctcttccctctcaactcagggcaccttaactcctaccttcaagcctatc
tttggcagcatagatccacttaaaactatgcccatgatagctcctttctcctccaagcag
acccctcctccatttactcatgcttctacccatcatttccatggcctggtcaaggccacc
actgtggtcatgcccaccaccctagccagcacatctaaagactctgtttttaagccacct
ttggattttggtgtagtgaatgttacaggtgccataggcaacacttattctgtcccttcc
acttgcgacactttcctgcttaggactgctcaggccttcagagccgacttcaccccagcc
acaggattcattttcccaccacaccaccgtcctaccattcctactgtgcacacagtcacc
atctttacccaggtcctttccagtgctgtccaaatatcccctagaagcagcactgctaat
ttcaggagtgtgggcagccctctgcccgcctcagccctagtatccacgaactggcctgca
tcgtcccccagcgtctccagcctgactccagcaatcacaagtcccttgggatcaagctca
aggccacctttcccactatcccaaggagctaatccccagcctgcatttggtgccacagat
ggacagaaacaagggccttcccagccagcccttactccaagtgtcagtagctcttttctt
tttgggagctcagcagtggcattgccaaccccagtgccaactccagctcagccagccttc
atcagtaccacacagtcagccttggggtgtttgataccctcagcctccacctctcaaacc
cctgccagcacctggccaggcattggcagcattccagcaggttttcccattagtcaagct
agtacaactgggtttagaattgtaattcagacccaccaaagtggggcttttggctcagtg
tttggcagcagagccccacgacctttcgcttttgggggattcgtgacccctatggactgt
gatgagtctgggattagaatgactggcccagacatgagctccacctccggagctttcagc
attggagcattgcctagtgggaccaccagtaccatgatcccatatggaaaaggctggagc
cagaacactcaaggcctgcccagccacagcacagcttttgccttggggagagccagcatt
tctgtaagaaagactatggcccccattgctcaaagcaccccagtccctggacaagctaag
gcaggcagcagtgttgactttgggatgccttttccacctgcccagggctctgttgggaga
ggaccttttagatcatcagcctcttcattttccatgggcacaaaatcaaaaacctcaaag
aatcgggaacaagggcattcccgaaggcatcatgcctacaagaagtag

DBGET integrated database retrieval system