KEGG   Macaca mulatta (rhesus monkey): 702424Help
Entry
702424            CDS       T01028                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    702424 (APOA4)
   04977 Vitamin digestion and absorption
    702424 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 440 aa AA seqDB search
MFLKAVVLTHAAALSGARAEVSAVLVASVMWDYFSQLSSNAKEAVEHLQKSELTQQLNAL
FQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIRKELEEVRARLLPHANEVS
QKIGENVRELQQRLEPYTDQLRTQVNTQTEQLRRQLTPYAQRMERVLRENADSLQTSLRP
HADQLKAKIDQNVEELKERLTPYADEFKVKIDQTVEELRRSLAPYAQDAQEKLNHQLEGL
AFQMKKNAEELKARISASAEELRQRLAPLAEDMRGNLRGNTEGLQKSLAELGGHLDRHVE
EFRLRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEK
ESQDNTLSLPEPEQQREQQQEQQQEQEQEQQQEQQQQQEQQQEQQQEQQQQQEQQREQQQ
QEQQQEQQQEQVQMLAPLES
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctgacccacgcggctgctctgagtggagcccgggctgag
gtcagtgctgttttggtggcctcggtgatgtgggactacttcagccagctgagcagcaat
gccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgccctc
ttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctggtg
ccctttgccaccgagctgcatgaacgcctggccaaggactcggagaaactgaaggaggag
attcggaaggagctggaggaggtgagggcccggctgctgccccatgccaatgaggtgagc
cagaagatcggggaaaatgtgcgagagctgcagcagcgcctggagccctacacggaccag
ctgcgcacccaggtcaacacgcagactgagcagctgcggcgccagctgaccccctacgca
cagcgcatggagagagtgctgcgggagaacgccgacagcctgcagacctcgctgaggccc
cacgcagaccagctcaaggccaagatcgaccagaacgtggaggagctcaaggagcgcctc
acgccctacgccgacgagttcaaagtcaagatcgaccagaccgtggaggagctgcgccgc
agcctggctccctatgctcaggacgcacaggagaagctcaaccaccagctcgagggcctg
gccttccagatgaagaagaacgccgaggagctcaaggccaggatctcggccagtgcggag
gagctgcggcagaggctggcgcccttggccgaggacatgcgtggcaacctgaggggcaac
accgaggggctgcagaagtcgctggcagagctgggcgggcacttggaccggcatgtggag
gagttccggctccgggtggagccctacggggagaacttcaacaaagctctggtgcagcag
atggaacagctcaggcagaagctgggcccccatgcgggggacgtggaaggccacttgagc
ttcctagagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggagaaa
gagagccaggacaacaccctctccctcccggagcccgagcagcagcgggagcagcagcag
gagcagcagcaggagcaggagcaggagcagcagcaggagcagcagcagcagcaggagcag
cagcaggagcagcagcaggagcagcagcagcagcaggagcagcagcgggagcagcagcag
caggagcagcagcaggagcagcagcaggagcaggtgcagatgctggcccctttggagagc
tga

DBGET integrated database retrieval system